Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07427
Gene name
Locationscaffold_11:40770..42172
Strand-
Gene length (bp)1402
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 3.0E-17 7 277

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.8925 0.4163 0.0817 0.0066 0.2853 0.0816 0.1205 0.0778 0.1366 0.3156

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup822
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4855
Ophiocordyceps australis map64 (Brazil) OphauB2|5298
Ophiocordyceps camponoti-floridani Ophcf2|02063
Ophiocordyceps camponoti-floridani Ophcf2|07427 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1033
Ophiocordyceps kimflemingae Ophio5|1249
Ophiocordyceps subramaniannii Hirsu2|3928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07427
MSLTNGSAEDIAAAARRASSTLAALSVADRDAALEAVYSALEAAREDILAANARDVQAARAAAGADPALVDRLDL
SRGREVWCRGYGFGRVQARTQLDDDLVLERVSCPIGVILVIFEARPEVIANIASLALKSGNAAILKGGKESTESF
IAISHAISSALKASSVVPPAAIQLVTTREHVGSLLAQHRDIDLVIPRGSNQLVRDIKLGTRIPVLGHADGLCAVY
LTDSADAEKAAALMVDAKTSYPAACNSVETLLVQESAVQTIFPVVAKALVEHGVTLLCDPPTRTSALSTVEDATL
IQEATPKDYTTEFLSKTLAVKTMSSLDEAIAHINAHGSHHTDAILTASAPDAERFMQRVDSAGVFWNASTRVADG
TRYGFGTEVGISTNKIHARGPVGLEGLTIYKYKLRGDYQPTAEYGTGKRRWKHEALPL*
Coding >Ophcf2|07427
ATGTCGCTTACCAACGGTTCGGCAGAGGATATCGCCGCCGCTGCTCGTCGAGCTTCCTCCACCTTGGCTGCTCTC
TCAGTCGCCGATCGTGACGCCGCTCTCGAGGCCGTGTATTCTGCTCTGGAGGCTGCGCGTGAGGATATCCTCGCT
GCCAATGCGAGGGATGTGCAGGCTGCGCGGGCTGCGGCTGGGGCGGATCCTGCTCTTGTCGACAGGTTGGATCTC
TCGAGGGGGAGGGAGGTATGGTGCAGGGGTTATGGATTTGGGAGGGTGCAGGCGCGGACGCAACTCGACGATGAC
CTGGTTCTCGAGAGGGTGAGCTGTCCGATAGGCGTCATCCTCGTCATCTTCGAAGCCCGACCCGAAGTCATCGCA
AACATCGCCTCCCTAGCCCTCAAATCCGGCAACGCCGCCATCCTAAAAGGCGGCAAAGAATCCACCGAGTCCTTC
ATCGCCATCTCCCACGCCATCTCCTCCGCCCTCAAAGCCTCGTCCGTCGTTCCCCCCGCCGCCATCCAACTCGTC
ACCACGCGCGAGCACGTTGGAAGCTTGCTCGCGCAGCATCGGGATATCGATCTCGTTATTCCCAGGGGCTCTAAC
CAGCTCGTTCGGGATATCAAGCTGGGGACTAGGATCCCCGTGCTGGGTCATGCCGATGGGCTTTGCGCCGTTTAT
CTTACGGATAGTGCGGATGCGGAAAAGGCTGCCGCTCTCATGGTCGACGCCAAGACGAGCTACCCGGCCGCCTGC
AACAGCGTGGAAACACTCCTCGTGCAAGAATCAGCAGTGCAAACAATCTTCCCCGTGGTGGCAAAAGCCCTGGTC
GAACACGGCGTCACCCTCCTCTGCGACCCCCCAACCCGAACCTCTGCTCTCTCCACCGTCGAGGACGCGACCCTC
ATCCAGGAAGCCACACCGAAGGACTACACAACGGAATTCCTCTCCAAGACGCTAGCCGTCAAGACGATGTCCTCG
CTCGACGAAGCGATAGCCCACATCAACGCCCACGGCTCTCACCACACAGACGCCATCCTCACGGCCTCGGCCCCC
GACGCGGAACGCTTCATGCAGCGCGTCGACTCGGCCGGGGTTTTCTGGAACGCTTCCACGCGCGTTGCCGACGGG
ACGCGCTACGGCTTCGGCACCGAGGTCGGCATCAGCACCAATAAGATTCACGCCCGAGGGCCTGTCGGTCTCGAG
GGACTCACCATTTACAAGTACAAGCTTCGCGGCGATTATCAACCTACGGCCGAGTATGGGACCGGCAAGCGGAGG
TGGAAGCATGAGGCCCTGCCTTTGTGA
Transcript >Ophcf2|07427
ATGTCGCTTACCAACGGTTCGGCAGAGGATATCGCCGCCGCTGCTCGTCGAGCTTCCTCCACCTTGGCTGCTCTC
TCAGTCGCCGATCGTGACGCCGCTCTCGAGGCCGTGTATTCTGCTCTGGAGGCTGCGCGTGAGGATATCCTCGCT
GCCAATGCGAGGGATGTGCAGGCTGCGCGGGCTGCGGCTGGGGCGGATCCTGCTCTTGTCGACAGGTTGGATCTC
TCGAGGGGGAGGGAGGTATGGTGCAGGGGTTATGGATTTGGGAGGGTGCAGGCGCGGACGCAACTCGACGATGAC
CTGGTTCTCGAGAGGGTGAGCTGTCCGATAGGCGTCATCCTCGTCATCTTCGAAGCCCGACCCGAAGTCATCGCA
AACATCGCCTCCCTAGCCCTCAAATCCGGCAACGCCGCCATCCTAAAAGGCGGCAAAGAATCCACCGAGTCCTTC
ATCGCCATCTCCCACGCCATCTCCTCCGCCCTCAAAGCCTCGTCCGTCGTTCCCCCCGCCGCCATCCAACTCGTC
ACCACGCGCGAGCACGTTGGAAGCTTGCTCGCGCAGCATCGGGATATCGATCTCGTTATTCCCAGGGGCTCTAAC
CAGCTCGTTCGGGATATCAAGCTGGGGACTAGGATCCCCGTGCTGGGTCATGCCGATGGGCTTTGCGCCGTTTAT
CTTACGGATAGTGCGGATGCGGAAAAGGCTGCCGCTCTCATGGTCGACGCCAAGACGAGCTACCCGGCCGCCTGC
AACAGCGTGGAAACACTCCTCGTGCAAGAATCAGCAGTGCAAACAATCTTCCCCGTGGTGGCAAAAGCCCTGGTC
GAACACGGCGTCACCCTCCTCTGCGACCCCCCAACCCGAACCTCTGCTCTCTCCACCGTCGAGGACGCGACCCTC
ATCCAGGAAGCCACACCGAAGGACTACACAACGGAATTCCTCTCCAAGACGCTAGCCGTCAAGACGATGTCCTCG
CTCGACGAAGCGATAGCCCACATCAACGCCCACGGCTCTCACCACACAGACGCCATCCTCACGGCCTCGGCCCCC
GACGCGGAACGCTTCATGCAGCGCGTCGACTCGGCCGGGGTTTTCTGGAACGCTTCCACGCGCGTTGCCGACGGG
ACGCGCTACGGCTTCGGCACCGAGGTCGGCATCAGCACCAATAAGATTCACGCCCGAGGGCCTGTCGGTCTCGAG
GGACTCACCATTTACAAGTACAAGCTTCGCGGCGATTATCAACCTACGGCCGAGTATGGGACCGGCAAGCGGAGG
TGGAAGCATGAGGCCCTGCCTTTGTGA
Gene >Ophcf2|07427
ATGTCGCTTACCAACGGTTCGGCAGAGGATATCGCCGCCGCTGCTCGTCGAGCTTCCTCCACCTTGGCTGCTCTC
TCAGTCGCCGATCGTGACGCCGCTCTCGAGGCCGTGTATTCTGCTCTGGAGGCTGCGCGTGAGGATATCCTCGCT
GCCAATGCGAGGGATGTGCAGGCTGCGCGGGCTGCGGCTGGGGCGGATCCTGCTCTTGTCGACAGGTTGGATCTC
TCGAGGGGGAGGGAGGTATGGTGCAGGGGTTATGGATGTGAGGCGGTTGGAGGATCCCAGTGAGTTTTTTTTTTT
TTTTTTTTTTTTCCCTTTGTTTGGAGCTCAGCTTGGTGTGGTGCTTGGCTGATGAGGGTTAGTTGGGAGGGTGCA
GGCGCGGACGCAACTCGACGATGACCTGGTTCTCGAGAGGGTGAGCTGTCCGATAGGCGTCATCCTCGTCATCTT
CGAAGCCCGACCCGAAGTCATCGCAAACATCGCCTCCCTAGCCCTCAAATCCGGCAACGCCGCCATCCTAAAAGG
CGGCAAAGAATCCACCGAGTCCTTCATCGCCATCTCCCACGCCATCTCCTCCGCCCTCAAAGCCTCGTCCGTCGT
TCCCCCCGCCGCCATCCAACTCGTCACCACGCGCGAGCACGTTGGAAGCTTGCTCGCGCAGCATCGGGATATCGA
TCTCGTTATTCCCAGGGGCTCTAACCAGCTCGTTCGGGATATCAAGCTGGGGACTAGGATCCCCGTGCTGGGTCA
TGCCGATGGGCTTTGCGCCGTTTATCTTACGGATAGTGCGGATGCGGAAAAGGCTGCCGCTCTCATGGTCGACGC
CAAGACGAGCTACCCGGCCGCCTGCAACAGCGTGGAAACACTCCTCGTGCAAGAATCAGCAGTGCAAACAATCTT
CCCCGTGGTGGCAAAAGCCCTGGTCGAACACGGCGTCACCCTCCTCTGCGACCCCCCAACCCGAACCTCTGCTCT
CTCCACCGTCGAGGACGCGACCCTCATCCAGGAAGCCACACCGAAGGACTACACAACGGAATTCCTCTCCAAGAC
GCTAGCCGTCAAGACGATGTCCTCGCTCGACGAAGCGATAGCCCACATCAACGCCCACGGCTCTCACCACACAGA
CGCCATCCTCACGGCCTCGGCCCCCGACGCGGAACGCTTCATGCAGCGCGTCGACTCGGCCGGGGTTTTCTGGAA
CGCTTCCACGCGCGTTGCCGACGGGACGCGCTACGGCTTCGGCACCGAGGTCGGCATCAGCACCAATAAGATTCA
CGCCCGAGGGCCTGTCGGTCTCGAGGGACTCACCATTTACAAGTACAAGCTTCGCGGCGATTATCAACCTACGGC
CGAGTATGGGACCGGCAAGCGGAGGTGGAAGCATGAGGCCCTGCCTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail