Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07379
Gene name
Locationscaffold_09:1351028..1351673
Strand-
Gene length (bp)645
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 1.2E-12 153 214

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6138 0.3333 0.5281 0.0424 0.3071 0.0345 0.4148 0.154 0.0201 0.3236

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup753
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7437
Ophiocordyceps australis map64 (Brazil) OphauB2|7805
Ophiocordyceps camponoti-floridani Ophcf2|07379 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3211
Ophiocordyceps kimflemingae Ophio5|5142
Ophiocordyceps subramaniannii Hirsu2|2236
Ophiocordyceps subramaniannii Hirsu2|6052
Ophiocordyceps subramaniannii Hirsu2|6054

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07379
MAFFPPQFYNSETSFTPLFRLLDDFDHHYRGSPQQHGRRSAGLPSWQPKFDIRETAENYELHGELPGIRKDQVNI
EFTDPQTMLIRGRVERSYSAGTPPAGAIEEAGERAAITEDGEASSSRNSLHQATVEDETDNNKTGVDEVAKTESA
VEKKKPQDKAKYWLTERSIGEFSRSFNFPSRVDQDGVSAQFKDGILEIVVPKAKKHESRRIAIN*
Coding >Ophcf2|07379
ATGGCTTTCTTCCCGCCTCAGTTTTACAACTCGGAGACGTCCTTCACGCCTCTCTTCCGCCTGCTGGATGACTTT
GATCACCACTATCGCGGGTCGCCGCAGCAGCATGGCCGCCGTAGCGCGGGCTTGCCCAGCTGGCAGCCCAAGTTC
GACATTCGCGAGACGGCTGAGAACTACGAGCTTCACGGCGAGCTTCCGGGAATAAGGAAGGATCAGGTCAACATC
GAATTCACCGACCCGCAGACCATGCTCATCCGCGGCCGTGTCGAGCGCTCTTACTCGGCTGGTACGCCGCCTGCG
GGTGCCATCGAGGAAGCGGGCGAGCGCGCAGCCATCACTGAAGATGGCGAGGCATCCTCTTCGCGCAACTCTCTT
CACCAAGCCACTGTCGAGGATGAAACGGATAACAACAAGACTGGCGTCGACGAGGTGGCCAAGACGGAGTCGGCC
GTCGAGAAGAAGAAGCCTCAGGACAAGGCCAAGTACTGGCTCACGGAGCGCAGCATCGGCGAGTTCTCGCGCAGC
TTCAACTTCCCTAGCCGCGTCGATCAGGATGGAGTCTCGGCTCAGTTCAAGGACGGCATCCTCGAGATAGTGGTG
CCCAAGGCTAAGAAGCACGAGTCGCGCCGCATCGCTATCAACTAA
Transcript >Ophcf2|07379
ATGGCTTTCTTCCCGCCTCAGTTTTACAACTCGGAGACGTCCTTCACGCCTCTCTTCCGCCTGCTGGATGACTTT
GATCACCACTATCGCGGGTCGCCGCAGCAGCATGGCCGCCGTAGCGCGGGCTTGCCCAGCTGGCAGCCCAAGTTC
GACATTCGCGAGACGGCTGAGAACTACGAGCTTCACGGCGAGCTTCCGGGAATAAGGAAGGATCAGGTCAACATC
GAATTCACCGACCCGCAGACCATGCTCATCCGCGGCCGTGTCGAGCGCTCTTACTCGGCTGGTACGCCGCCTGCG
GGTGCCATCGAGGAAGCGGGCGAGCGCGCAGCCATCACTGAAGATGGCGAGGCATCCTCTTCGCGCAACTCTCTT
CACCAAGCCACTGTCGAGGATGAAACGGATAACAACAAGACTGGCGTCGACGAGGTGGCCAAGACGGAGTCGGCC
GTCGAGAAGAAGAAGCCTCAGGACAAGGCCAAGTACTGGCTCACGGAGCGCAGCATCGGCGAGTTCTCGCGCAGC
TTCAACTTCCCTAGCCGCGTCGATCAGGATGGAGTCTCGGCTCAGTTCAAGGACGGCATCCTCGAGATAGTGGTG
CCCAAGGCTAAGAAGCACGAGTCGCGCCGCATCGCTATCAACTAA
Gene >Ophcf2|07379
ATGGCTTTCTTCCCGCCTCAGTTTTACAACTCGGAGACGTCCTTCACGCCTCTCTTCCGCCTGCTGGATGACTTT
GATCACCACTATCGCGGGTCGCCGCAGCAGCATGGCCGCCGTAGCGCGGGCTTGCCCAGCTGGCAGCCCAAGTTC
GACATTCGCGAGACGGCTGAGAACTACGAGCTTCACGGCGAGCTTCCGGGAATAAGGAAGGATCAGGTCAACATC
GAATTCACCGACCCGCAGACCATGCTCATCCGCGGCCGTGTCGAGCGCTCTTACTCGGCTGGTACGCCGCCTGCG
GGTGCCATCGAGGAAGCGGGCGAGCGCGCAGCCATCACTGAAGATGGCGAGGCATCCTCTTCGCGCAACTCTCTT
CACCAAGCCACTGTCGAGGATGAAACGGATAACAACAAGACTGGCGTCGACGAGGTGGCCAAGACGGAGTCGGCC
GTCGAGAAGAAGAAGCCTCAGGACAAGGCCAAGTACTGGCTCACGGAGCGCAGCATCGGCGAGTTCTCGCGCAGC
TTCAACTTCCCTAGCCGCGTCGATCAGGATGGAGTCTCGGCTCAGTTCAAGGACGGCATCCTCGAGATAGTGGTG
CCCAAGGCTAAGAAGCACGAGTCGCGCCGCATCGCTATCAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail