Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07373
Gene name
Locationscaffold_09:1338229..1339786
Strand-
Gene length (bp)1557
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03224 V-ATPase_H_N V-ATPase subunit H 3.3E-75 8 350
PF11698 V-ATPase_H_C V-ATPase subunit H 5.8E-35 358 475

GO

GO Term Description Terminal node
GO:1902600 proton transmembrane transport Yes
GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0015078 proton transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0034220 ion transmembrane transport No
GO:0098655 cation transmembrane transport No
GO:0005215 transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0033180 proton-transporting V-type ATPase, V1 domain No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0006810 transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098660 inorganic ion transmembrane transport No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015399 primary active transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0098796 membrane protein complex No
GO:0015075 ion transmembrane transporter activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0006812 cation transport No
GO:0022853 active ion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No
GO:0005575 cellular_component No
GO:0098662 inorganic cation transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5311 0.6873 0.0157 0.0749 0.2388 0.0129 0.251 0.157 0.1785 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2163
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5570
Ophiocordyceps australis map64 (Brazil) OphauB2|7799
Ophiocordyceps camponoti-floridani Ophcf2|07373 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3217
Ophiocordyceps kimflemingae Ophio5|5148
Ophiocordyceps subramaniannii Hirsu2|2669

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07373
MSLEPPTYLASLQSNIRQRPIPWDGAVRAGTLTEEQYETIRAVDKAKNAEQRRHVVEADVDAYRLLFVGGPDRPS
VLETAAKHANVIQYILVLLTDLVQAVPSLAKALLDTREPYQHFLPLLRSTAPEDPIPLLTAHALADIASLARDES
SATRQALPVILTYLSGLAKSSDAGLQDIAVQECSSLLYGHVSRDQFWKQRSETVAPLIAILQSAAGINGENTTAN
LWSGVSTVRSAGLDGSLGGGVGLQLLYHVLLVMWQLSFEADEIGDELNDEYDIVLLYSHLLRLSPKEKTTRLMLS
TLYNLLDKNQKTLLPTAVLARLPALLVNLSSRHLTDPDLLEELESLKALLDEYTKTKTTLDEYVAEVQSGHLRWS
PPHRSQTFWAENARKILEFENGEIARRLADIMQKPWDNDKQVLAIACNDIGCLVKEVPERRHQLEKVGLKRRVME
LMQSDDENVRWESLRALGGWLKYSFEQ*
Coding >Ophcf2|07373
ATGTCGCTCGAGCCCCCGACGTATCTGGCTTCGCTGCAGAGCAACATTCGCCAGCGTCCGATCCCCTGGGATGGC
GCCGTCAGGGCCGGCACCTTGACAGAGGAACAGTACGAGACCATCCGGGCCGTCGACAAGGCAAAGAATGCCGAG
CAGAGGCGGCATGTCGTCGAGGCCGATGTTGACGCCTACCGGCTGCTGTTCGTCGGCGGACCCGACAGGCCGAGC
GTCCTCGAGACGGCGGCCAAGCACGCCAACGTCATTCAGTATATCCTCGTCTTACTCACCGACCTCGTCCAGGCC
GTTCCGTCCCTTGCAAAGGCGCTGCTCGATACCCGCGAACCCTACCAACATTTCCTACCGCTGCTGCGCTCTACC
GCCCCCGAAGATCCCATTCCGCTGCTCACGGCCCACGCGCTGGCAGATATTGCTTCCCTCGCGAGGGACGAGTCG
TCGGCCACCCGTCAGGCGCTACCGGTCATCCTCACCTATCTGTCCGGCCTGGCCAAGAGCTCCGACGCCGGTCTG
CAGGATATTGCCGTTCAGGAGTGCTCGTCTCTGCTATACGGACACGTCTCTCGTGATCAGTTTTGGAAGCAGAGG
AGTGAGACGGTGGCCCCGCTCATCGCCATTCTCCAGTCGGCCGCCGGCATCAACGGCGAGAACACGACGGCCAAT
CTTTGGAGCGGCGTCTCTACTGTTCGCTCGGCCGGCTTGGATGGCTCCCTGGGCGGTGGCGTCGGCCTGCAGCTT
CTATACCATGTGCTGCTCGTCATGTGGCAGCTGAGCTTCGAAGCCGATGAGATTGGCGATGAGCTCAACGACGAG
TACGACATTGTTCTTCTATACTCTCACCTCTTGCGGCTGTCGCCCAAAGAAAAGACGACGCGGCTGATGCTGTCG
ACGCTCTACAACCTGCTGGATAAGAACCAGAAGACGTTGCTACCCACGGCAGTCCTGGCCCGGCTCCCGGCGCTG
CTGGTCAACCTGAGCAGCCGGCATCTGACGGATCCGGATCTTCTCGAGGAGCTCGAGAGCCTCAAGGCGCTGCTG
GACGAGTACACCAAAACCAAGACGACGCTGGACGAGTACGTGGCCGAGGTGCAGTCGGGTCACCTGCGCTGGTCG
CCGCCGCACCGGAGCCAGACGTTCTGGGCAGAGAATGCGCGCAAGATACTCGAGTTTGAGAACGGCGAGATTGCG
CGGCGGCTGGCTGACATTATGCAGAAGCCGTGGGACAATGACAAGCAGGTGCTGGCCATTGCCTGCAATGATATC
GGCTGTCTGGTCAAGGAGGTGCCGGAGAGGCGTCACCAGCTGGAGAAGGTTGGTCTGAAGAGGAGGGTCATGGAG
CTGATGCAGTCGGACGACGAGAACGTCCGGTGGGAGAGCCTACGGGCGCTGGGCGGATGGCTCAAGTATAGCTTT
GAGCAGTAG
Transcript >Ophcf2|07373
ATGTCGCTCGAGCCCCCGACGTATCTGGCTTCGCTGCAGAGCAACATTCGCCAGCGTCCGATCCCCTGGGATGGC
GCCGTCAGGGCCGGCACCTTGACAGAGGAACAGTACGAGACCATCCGGGCCGTCGACAAGGCAAAGAATGCCGAG
CAGAGGCGGCATGTCGTCGAGGCCGATGTTGACGCCTACCGGCTGCTGTTCGTCGGCGGACCCGACAGGCCGAGC
GTCCTCGAGACGGCGGCCAAGCACGCCAACGTCATTCAGTATATCCTCGTCTTACTCACCGACCTCGTCCAGGCC
GTTCCGTCCCTTGCAAAGGCGCTGCTCGATACCCGCGAACCCTACCAACATTTCCTACCGCTGCTGCGCTCTACC
GCCCCCGAAGATCCCATTCCGCTGCTCACGGCCCACGCGCTGGCAGATATTGCTTCCCTCGCGAGGGACGAGTCG
TCGGCCACCCGTCAGGCGCTACCGGTCATCCTCACCTATCTGTCCGGCCTGGCCAAGAGCTCCGACGCCGGTCTG
CAGGATATTGCCGTTCAGGAGTGCTCGTCTCTGCTATACGGACACGTCTCTCGTGATCAGTTTTGGAAGCAGAGG
AGTGAGACGGTGGCCCCGCTCATCGCCATTCTCCAGTCGGCCGCCGGCATCAACGGCGAGAACACGACGGCCAAT
CTTTGGAGCGGCGTCTCTACTGTTCGCTCGGCCGGCTTGGATGGCTCCCTGGGCGGTGGCGTCGGCCTGCAGCTT
CTATACCATGTGCTGCTCGTCATGTGGCAGCTGAGCTTCGAAGCCGATGAGATTGGCGATGAGCTCAACGACGAG
TACGACATTGTTCTTCTATACTCTCACCTCTTGCGGCTGTCGCCCAAAGAAAAGACGACGCGGCTGATGCTGTCG
ACGCTCTACAACCTGCTGGATAAGAACCAGAAGACGTTGCTACCCACGGCAGTCCTGGCCCGGCTCCCGGCGCTG
CTGGTCAACCTGAGCAGCCGGCATCTGACGGATCCGGATCTTCTCGAGGAGCTCGAGAGCCTCAAGGCGCTGCTG
GACGAGTACACCAAAACCAAGACGACGCTGGACGAGTACGTGGCCGAGGTGCAGTCGGGTCACCTGCGCTGGTCG
CCGCCGCACCGGAGCCAGACGTTCTGGGCAGAGAATGCGCGCAAGATACTCGAGTTTGAGAACGGCGAGATTGCG
CGGCGGCTGGCTGACATTATGCAGAAGCCGTGGGACAATGACAAGCAGGTGCTGGCCATTGCCTGCAATGATATC
GGCTGTCTGGTCAAGGAGGTGCCGGAGAGGCGTCACCAGCTGGAGAAGGTTGGTCTGAAGAGGAGGGTCATGGAG
CTGATGCAGTCGGACGACGAGAACGTCCGGTGGGAGAGCCTACGGGCGCTGGGCGGATGGCTCAAGTATAGCTTT
GAGCAGTAG
Gene >Ophcf2|07373
ATGTCGCTCGAGCCCCCGACGTATCTGGCTTCGCTGCAGAGCAACATTCGCCAGCGTCCGATCCCCTGGGATGGC
GCCGTCAGGGCCGGCACCTTGACAGAGGAACAGTACGAGACCATCCGGGCCGTCGACAAGGCAAAGAATGCCGAG
CAGAGGCGGCATGTCGTCGAGGCCGATGTTGACGCCTACCGGCTGCTGTTCGTCGGCGGACCCGACAGGCCGAGC
GTCCTCGAGACGGCGGCCAAGCACGCCAACGTCATTCAGTATATCCTCGTCTTACTCACCGACCTCGTCCAGGGT
GAGTTTCTGATTTCTTTTGGACTGATGCGGTGGCCCGTGAGCTCATTGCTATTTAGCCGTTCCGTCCCTTGCAAA
GGCGCTGCTCGATACCCGCGAACCCTACCAACATTTCCTACCGCTGCTGCGCTCTACCGCCCCCGAAGATCCCAT
TCCGCTGCTCACGGCCCACGCGCTGGCAGATATTGCTTCCCTCGCGAGGGACGAGTCGTCGGCCACCCGTCAGGC
GCTACCGGTCATCCTCACCTATCTGTCCGGCCTGGCCAAGAGCTCCGACGCCGGTCTGCAGGATATTGCCGTTCA
GGAGTGCTCGTCTCTGCTATACGGACACGTCTCTCGTGATCAGTTTTGGAAGCAGAGGAGTGAGACGGTGGCCCC
GCTCATCGCCATTCTCCAGTCGGCCGCCGGCATCAACGGCGAGAACACGACGGCCAATCTTTGGAGCGGCGTCTC
TACTGTTCGCTCGGCCGGCTTGGATGGCTCCCTGGGCGGTGGCGTCGGCCTGCAGCTTCTATACCATGTGCTGCT
CGTCATGTGGCAGCTGAGCTTCGAAGCCGATGAGATTGGCGATGAGCTCAACGAGTGAGTCGGCCCGCGTCTCGC
ATCGTGGAGACGTCAAATACTGACAGGTGCGGCGTGATGCATAGCGAGTACGACATTGTTCTTCTATACTCTCAC
CTCTTGCGGCTGTCGCCCAAAGAAAAGACGACGCGGCTGATGCTGTCGACGCTCTACAACCTGCTGGATAAGAAC
CAGAAGACGTTGCTACCCACGGCAGTCCTGGCCCGGCTCCCGGCGCTGCTGGTCAACCTGAGCAGCCGGCATCTG
ACGGATCCGGATCTTCTCGAGGAGCTCGAGAGCCTCAAGGCGCTGCTGGACGAGTACACCAAAACCAAGACGACG
CTGGACGAGTACGTGGCCGAGGTGCAGTCGGGTCACCTGCGCTGGTCGCCGCCGCACCGGAGCCAGACGTTCTGG
GCAGAGAATGCGCGCAAGATACTCGAGTTTGAGAACGGCGAGATTGCGCGGCGGCTGGCTGACATTATGCAGAAG
CCGTGGGACAATGACAAGCAGGTGCTGGCCATTGCCTGCAATGATATCGGCTGTCTGGTCAAGGAGGTGCCGGAG
AGGCGTCACCAGCTGGAGAAGGTTGGTCTGAAGAGGAGGGTCATGGAGCTGATGCAGTCGGACGACGAGAACGTC
CGGTGGGAGAGCCTACGGGCGCTGGGCGGATGGCTCAAGTATAGCTTTGAGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail