Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07367
Gene name
Locationscaffold_09:1318646..1320523
Strand-
Gene length (bp)1877
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 5.0E-103 80 554

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.161 0.0928 0.0688 0.0433 0.869 0.0858 0.0256 0.0522 0.0658 0.0873

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4472
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1252
Ophiocordyceps australis map64 (Brazil) OphauB2|7788
Ophiocordyceps camponoti-floridani Ophcf2|07367 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4663
Ophiocordyceps kimflemingae Ophio5|5558
Ophiocordyceps subramaniannii Hirsu2|9313

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07367
MQSATFNRAGLRCASQASQRLGMGSFAAFKTPKVANEANHHYGKGSSQRQGLMAAVDKMQKWLPVDIPVIIGGTK
IQSSTKASQHNPSDHSIKVASYTPATAADVSRAIDSALSAKPTWESLPFADRAAVFLKAADLIGGKYRYDVMAAT
MLGQGKNAWQAEIDAAAELVDFFRFNVHYAEQLLAQQPEHHAPGVWNRLEYRPLEGFVYAVSPFNFTAIAGNLPG
APALMGNVVVWKPSDHAILSNWLVYEILLEAGLPPDVIQFVPGDAKEVTDVALRHDQLAALHFTGSTAVFRHLYG
VIGQGISEGRYRSYPRIVGETGGKNFHLIHPSADMDNAAIHTVRGAFEFQGQKCSATSRLYAPRSAWPRLKERLV
AETRELAVGSPLEPDNFMGPVIHAAAFDKLTTAMDSASRDSELELLVGGEGDKSKGYFVQPTIYQTSNPSHNFLT
TEFFGPLLTVYVYDDSTAESFESACKLVDWTSGYGLTGSVFAADRTAIRTAEEALRHAAGNFYVNCKCTGAVVGQ
QAFGGARASGTDDKAGSGNLLTRFVNIRAIKEEFGAAERVAYPSNEV*
Coding >Ophcf2|07367
ATGCAGTCGGCTACGTTCAACAGGGCAGGTCTACGATGCGCCAGTCAGGCTTCTCAGCGGCTGGGGATGGGATCG
TTCGCGGCGTTCAAGACGCCCAAGGTTGCTAATGAGGCGAATCATCATTATGGCAAGGGAAGTTCTCAGCGGCAG
GGTCTTATGGCTGCTGTCGATAAGATGCAGAAGTGGCTCCCCGTCGATATCCCCGTCATCATCGGCGGAACAAAG
ATCCAATCCTCCACCAAGGCATCCCAGCATAACCCTTCGGACCACTCGATAAAGGTAGCATCCTACACGCCCGCC
ACGGCCGCCGACGTATCCCGCGCCATCGACTCTGCCCTCTCGGCGAAACCAACATGGGAATCCCTCCCCTTCGCA
GACCGCGCCGCCGTCTTCCTCAAGGCGGCGGATCTCATCGGCGGGAAATACCGTTACGATGTCATGGCTGCTACC
ATGCTGGGACAGGGAAAGAATGCGTGGCAGGCCGAGATCGACGCCGCGGCTGAGCTGGTGGACTTCTTTCGCTTC
AACGTTCATTATGCCGAGCAGCTTCTCGCTCAGCAGCCGGAGCATCACGCGCCCGGCGTTTGGAACCGGCTCGAA
TACCGTCCGCTGGAGGGCTTCGTCTACGCCGTCAGCCCCTTCAACTTCACCGCCATAGCAGGGAACCTCCCCGGT
GCCCCAGCACTGATGGGCAACGTCGTCGTCTGGAAACCGAGCGATCACGCCATCCTCTCCAACTGGCTCGTCTAC
GAGATCCTCCTAGAGGCCGGTCTGCCCCCAGACGTCATCCAGTTCGTGCCGGGTGACGCCAAGGAGGTGACGGAC
GTTGCTCTCCGTCACGACCAACTCGCGGCCCTGCACTTCACAGGCAGCACCGCCGTCTTCCGCCATCTCTACGGC
GTCATCGGTCAGGGAATATCCGAGGGTCGATACCGGTCGTACCCGCGCATCGTGGGCGAAACGGGCGGTAAGAAC
TTTCACCTCATCCACCCATCGGCCGACATGGACAACGCAGCCATCCACACCGTCCGCGGCGCCTTCGAATTCCAA
GGCCAGAAATGCAGCGCGACTTCTCGTCTTTACGCGCCGCGGTCTGCGTGGCCACGGTTGAAGGAGAGGCTGGTG
GCTGAGACGCGCGAGCTGGCTGTTGGGTCTCCTCTTGAGCCGGACAACTTCATGGGTCCTGTCATTCACGCTGCT
GCTTTCGACAAGCTGACTACGGCCATGGACTCGGCGTCTCGCGATTCGGAACTCGAACTGCTTGTCGGAGGCGAG
GGCGACAAGTCCAAGGGCTACTTCGTCCAGCCCACCATCTACCAAACCAGCAACCCATCCCACAACTTCCTGACA
ACCGAGTTCTTCGGGCCCCTACTGACGGTGTACGTCTACGACGACTCGACAGCCGAAAGCTTCGAATCAGCCTGC
AAGCTCGTAGATTGGACGTCGGGATACGGCCTCACGGGATCCGTCTTCGCCGCCGACCGGACGGCGATCCGGACG
GCGGAGGAGGCGCTGAGGCACGCGGCCGGCAACTTCTACGTCAACTGCAAGTGCACGGGTGCCGTCGTCGGGCAG
CAGGCCTTTGGGGGCGCGCGGGCGAGCGGCACGGATGACAAGGCGGGTAGTGGGAACCTGCTGACGCGCTTTGTT
AATATCAGGGCTATCAAGGAGGAGTTTGGGGCGGCGGAGCGGGTGGCGTATCCGAGTAACGAGGTGTGA
Transcript >Ophcf2|07367
ATGCAGTCGGCTACGTTCAACAGGGCAGGTCTACGATGCGCCAGTCAGGCTTCTCAGCGGCTGGGGATGGGATCG
TTCGCGGCGTTCAAGACGCCCAAGGTTGCTAATGAGGCGAATCATCATTATGGCAAGGGAAGTTCTCAGCGGCAG
GGTCTTATGGCTGCTGTCGATAAGATGCAGAAGTGGCTCCCCGTCGATATCCCCGTCATCATCGGCGGAACAAAG
ATCCAATCCTCCACCAAGGCATCCCAGCATAACCCTTCGGACCACTCGATAAAGGTAGCATCCTACACGCCCGCC
ACGGCCGCCGACGTATCCCGCGCCATCGACTCTGCCCTCTCGGCGAAACCAACATGGGAATCCCTCCCCTTCGCA
GACCGCGCCGCCGTCTTCCTCAAGGCGGCGGATCTCATCGGCGGGAAATACCGTTACGATGTCATGGCTGCTACC
ATGCTGGGACAGGGAAAGAATGCGTGGCAGGCCGAGATCGACGCCGCGGCTGAGCTGGTGGACTTCTTTCGCTTC
AACGTTCATTATGCCGAGCAGCTTCTCGCTCAGCAGCCGGAGCATCACGCGCCCGGCGTTTGGAACCGGCTCGAA
TACCGTCCGCTGGAGGGCTTCGTCTACGCCGTCAGCCCCTTCAACTTCACCGCCATAGCAGGGAACCTCCCCGGT
GCCCCAGCACTGATGGGCAACGTCGTCGTCTGGAAACCGAGCGATCACGCCATCCTCTCCAACTGGCTCGTCTAC
GAGATCCTCCTAGAGGCCGGTCTGCCCCCAGACGTCATCCAGTTCGTGCCGGGTGACGCCAAGGAGGTGACGGAC
GTTGCTCTCCGTCACGACCAACTCGCGGCCCTGCACTTCACAGGCAGCACCGCCGTCTTCCGCCATCTCTACGGC
GTCATCGGTCAGGGAATATCCGAGGGTCGATACCGGTCGTACCCGCGCATCGTGGGCGAAACGGGCGGTAAGAAC
TTTCACCTCATCCACCCATCGGCCGACATGGACAACGCAGCCATCCACACCGTCCGCGGCGCCTTCGAATTCCAA
GGCCAGAAATGCAGCGCGACTTCTCGTCTTTACGCGCCGCGGTCTGCGTGGCCACGGTTGAAGGAGAGGCTGGTG
GCTGAGACGCGCGAGCTGGCTGTTGGGTCTCCTCTTGAGCCGGACAACTTCATGGGTCCTGTCATTCACGCTGCT
GCTTTCGACAAGCTGACTACGGCCATGGACTCGGCGTCTCGCGATTCGGAACTCGAACTGCTTGTCGGAGGCGAG
GGCGACAAGTCCAAGGGCTACTTCGTCCAGCCCACCATCTACCAAACCAGCAACCCATCCCACAACTTCCTGACA
ACCGAGTTCTTCGGGCCCCTACTGACGGTGTACGTCTACGACGACTCGACAGCCGAAAGCTTCGAATCAGCCTGC
AAGCTCGTAGATTGGACGTCGGGATACGGCCTCACGGGATCCGTCTTCGCCGCCGACCGGACGGCGATCCGGACG
GCGGAGGAGGCGCTGAGGCACGCGGCCGGCAACTTCTACGTCAACTGCAAGTGCACGGGTGCCGTCGTCGGGCAG
CAGGCCTTTGGGGGCGCGCGGGCGAGCGGCACGGATGACAAGGCGGGTAGTGGGAACCTGCTGACGCGCTTTGTT
AATATCAGGGCTATCAAGGAGGAGTTTGGGGCGGCGGAGCGGGTGGCGTATCCGAGTAACGAGGTGTGA
Gene >Ophcf2|07367
ATGCAGTCGGCTACGTTCAACAGGGCAGGTCTACGATGCGCCAGTCAGGCTTCTCAGCGGCTGGGGATGGGATCG
TTCGCGGCGTTCAAGACGCCCAAGGTTGCTAATGAGGCGAATGTGAGTTGATGACCACTGCGTTTACGAGAGGTA
TGGATGGATGGATGGATGGATGGATGGTTGGTTGGTTGGATGACGAGGGCTGACCATAGTAGCATCATTATGGCA
AGGGAAGTTCTCAGCGGCAGGGTCTTATGGCTGCTGTCGATAAGATGCAGAAGTGGCTCCCCGTCGATATCCCCG
TCATCATCGGCGGAACAAAGGTGAGCTCAACCCCCCCCCTCGTTCCCAACCACCACCACCACCAGTTCTCACAAC
TCCCCCAGATCCAATCCTCCACCAAGGCATCCCAGCATAACCCTTCGGACCACTCGATAAAGGTAGCATCCTACA
CGCCCGCCACGGCCGCCGACGTATCCCGCGCCATCGACTCTGCCCTCTCGGCGAAACCAACATGGGAATCCCTCC
CCTTCGCAGACCGCGCCGCCGTCTTCCTCAAGGCGGCGGATCTCATCGGCGGGAAATACCGTTACGATGTCATGG
CTGCTACCATGCTGGGACAGGGAAAGAATGCGTGGCAGGCCGAGATCGACGCCGCGGCTGAGCTGGTGGACTTCT
TTCGCTTCAACGTTCATTATGCCGAGCAGCTTCTCGCTCAGCAGCCGGAGCATCACGCGCCCGGCGTTTGGAACC
GGCTCGAATACCGTCCGCTGGAGGGCTTCGTCTACGCCGTCAGCCCCTTCAACTTCACCGCCATAGCAGGGAACC
TCCCCGGTGCCCCAGCACTGATGGGCAACGTCGTCGTCTGGAAACCGAGCGATCACGCCATCCTCTCCAACTGGC
TCGTCTACGAGATCCTCCTAGAGGCCGGTCTGCCCCCAGACGTCATCCAGTTCGTGCCGGGTGACGCCAAGGAGG
TGACGGACGTTGCTCTCCGTCACGACCAACTCGCGGCCCTGCACTTCACAGGCAGCACCGCCGTCTTCCGCCATC
TCTACGGCGTCATCGGTCAGGGAATATCCGAGGGTCGATACCGGTCGTACCCGCGCATCGTGGGCGAAACGGGCG
GTAAGAACTTTCACCTCATCCACCCATCGGCCGACATGGACAACGCAGCCATCCACACCGTCCGCGGCGCCTTCG
AATTCCAAGGCCAGAAATGCAGCGCGACTTCTCGTCTTTACGCGCCGCGGTCTGCGTGGCCACGGTTGAAGGAGA
GGCTGGTGGCTGAGACGCGCGAGCTGGCTGTTGGGTCTCCTCTTGAGCCGGACAACTTCATGGGTCCTGTCATTC
ACGCTGCTGCTTTCGACAAGCTGACTACGGCCATGGACTCGGCGTCTCGCGATTCGGAACTCGAACTGCTTGTCG
GAGGCGAGGGCGACAAGTCCAAGGGCTACTTCGTCCAGCCCACCATCTACCAAACCAGCAACCCATCCCACAACT
TCCTGACAACCGAGTTCTTCGGGCCCCTACTGACGGTGTACGTCTACGACGACTCGACAGCCGAAAGCTTCGAAT
CAGCCTGCAAGCTCGTAGATTGGACGTCGGGATACGGCCTCACGGGATCCGTCTTCGCCGCCGACCGGACGGCGA
TCCGGACGGCGGAGGAGGCGCTGAGGCACGCGGCCGGCAACTTCTACGTCAACTGCAAGTGCACGGGTGCCGTCG
TCGGGCAGCAGGCCTTTGGGGGCGCGCGGGCGAGCGGCACGGATGACAAGGCGGGTAGTGGGAACCTGCTGACGC
GCTTTGTTAATATCAGGGCTATCAAGGAGGAGTTTGGGGCGGCGGAGCGGGTGGCGTATCCGAGTAACGAGGTGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail