Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07366
Gene name
Locationscaffold_09:1316729..1317207
Strand-
Gene length (bp)478
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.5E-06 1 36

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2858 0.9385 0.0039 0.0391 0.0599 0.0185 0.0459 0.0133 0.0262 0.0534

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5760
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2822
Ophiocordyceps australis map64 (Brazil) OphauB2|7787
Ophiocordyceps camponoti-floridani Ophcf2|07366 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|587
Ophiocordyceps kimflemingae Ophio5|7074
Ophiocordyceps subramaniannii Hirsu2|9315

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07366
MNDEFAELKGLVPACQGEMHKLAILQASIDYIRYLQDCVDRLTRLRCDQPHPLSAFGALGSEADSRLPTPPASYQ
RDRPCRCFSPDSDVLVTSRKLNPPVHEAPKALLMLGKNQKDSKRGLAIRDLLADS*
Coding >Ophcf2|07366
ATGAACGATGAGTTCGCCGAGCTCAAGGGCCTGGTGCCGGCTTGTCAGGGGGAGATGCACAAACTGGCCATCCTT
CAGGCTTCCATCGACTATATTCGATACCTGCAAGACTGCGTCGATCGGCTGACACGACTCCGATGCGACCAGCCT
CATCCCTTGAGCGCATTCGGAGCCCTCGGAAGCGAAGCCGACTCACGTTTGCCGACGCCTCCAGCCTCCTACCAG
CGAGATAGGCCCTGCCGCTGCTTCTCTCCCGACTCTGACGTCCTCGTCACCAGCCGCAAGCTGAATCCGCCCGTC
CATGAAGCCCCCAAGGCACTCTTGATGCTCGGAAAGAACCAAAAGGACAGTAAACGCGGTCTCGCCATCCGAGAC
CTGCTCGCCGACAGCTAA
Transcript >Ophcf2|07366
ATGAACGATGAGTTCGCCGAGCTCAAGGGCCTGGTGCCGGCTTGTCAGGGGGAGATGCACAAACTGGCCATCCTT
CAGGCTTCCATCGACTATATTCGATACCTGCAAGACTGCGTCGATCGGCTGACACGACTCCGATGCGACCAGCCT
CATCCCTTGAGCGCATTCGGAGCCCTCGGAAGCGAAGCCGACTCACGTTTGCCGACGCCTCCAGCCTCCTACCAG
CGAGATAGGCCCTGCCGCTGCTTCTCTCCCGACTCTGACGTCCTCGTCACCAGCCGCAAGCTGAATCCGCCCGTC
CATGAAGCCCCCAAGGCACTCTTGATGCTCGGAAAGAACCAAAAGGACAGTAAACGCGGTCTCGCCATCCGAGAC
CTGCTCGCCGACAGCTAA
Gene >Ophcf2|07366
ATGAACGATGAGTTCGCCGAGCTCAAGGGCCTGGTGCCGGCTTGTCAGGGGGAGATGCACAAACTGGCCATCCTT
CAGGTACCGTCTTCCGGGGCCCCCGGTGTTGTACTCTGCTGAGGCGTGTATGATAGGGGAGGCAGGGCTGACAAT
CGTCGTCCAAAAGGCTTCCATCGACTATATTCGATACCTGCAAGACTGCGTCGATCGGCTGACACGACTCCGATG
CGACCAGCCTCATCCCTTGAGCGCATTCGGAGCCCTCGGAAGCGAAGCCGACTCACGTTTGCCGACGCCTCCAGC
CTCCTACCAGCGAGATAGGCCCTGCCGCTGCTTCTCTCCCGACTCTGACGTCCTCGTCACCAGCCGCAAGCTGAA
TCCGCCCGTCCATGAAGCCCCCAAGGCACTCTTGATGCTCGGAAAGAACCAAAAGGACAGTAAACGCGGTCTCGC
CATCCGAGACCTGCTCGCCGACAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail