Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07363
Gene name
Locationscaffold_09:1311240..1311828
Strand+
Gene length (bp)588
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00829 Ribosomal_L21p Ribosomal prokaryotic L21 protein 7.6E-12 60 162

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0005575 cellular_component No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.4006 0.2269 0.0888 0.0183 0.6547 0.4037 0.1761 0.0604 0.0365 0.346

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5664
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2819
Ophiocordyceps australis map64 (Brazil) OphauB2|7784
Ophiocordyceps camponoti-floridani Ophcf2|07363 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6462
Ophiocordyceps kimflemingae Ophio5|7077
Ophiocordyceps subramaniannii Hirsu2|8161

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07363
MIDYPIPKPPPPNPKNAPNPTRDLVRPYALKKSHPNAPPAPIADSVKHLLPVLAAQPGHYITVHIHGFPYLVQQG
DQVRLPFRMPDVVPGDVLRLNRASVLGSRDYTMKGSPHIDERLFICRATVLGVESEPMRIKIKKKRRCRKKKQAK
SKLRYTILRISELDIVTAAPVDEGAAEGKSAGESVESSNRVEKEG*
Coding >Ophcf2|07363
ATGATCGACTACCCGATACCGAAGCCTCCCCCCCCGAACCCCAAGAACGCGCCCAACCCGACACGCGATCTCGTA
CGGCCCTACGCGCTGAAGAAGAGTCATCCGAACGCACCGCCCGCGCCAATTGCCGATTCGGTTAAGCATCTGCTG
CCCGTGCTGGCCGCCCAGCCGGGACACTACATCACCGTCCACATCCACGGCTTCCCATACCTCGTGCAGCAGGGC
GATCAGGTGCGGCTGCCTTTTCGAATGCCTGACGTCGTCCCCGGCGATGTGCTTCGCTTGAACCGCGCGAGCGTG
CTGGGCAGTCGCGATTACACGATGAAGGGGTCGCCGCATATTGACGAGCGGCTCTTTATCTGCCGCGCTACGGTG
CTGGGGGTGGAGTCGGAGCCGATGCGCATCAAGATCAAGAAAAAGCGGCGGTGTCGGAAGAAGAAGCAGGCCAAG
TCGAAGCTTCGCTACACCATTCTGAGGATATCGGAGCTCGATATTGTGACGGCTGCGCCAGTTGATGAGGGTGCG
GCTGAGGGGAAATCGGCTGGGGAATCGGTCGAGAGCTCGAATCGAGTCGAGAAGGAAGGGTGA
Transcript >Ophcf2|07363
ATGATCGACTACCCGATACCGAAGCCTCCCCCCCCGAACCCCAAGAACGCGCCCAACCCGACACGCGATCTCGTA
CGGCCCTACGCGCTGAAGAAGAGTCATCCGAACGCACCGCCCGCGCCAATTGCCGATTCGGTTAAGCATCTGCTG
CCCGTGCTGGCCGCCCAGCCGGGACACTACATCACCGTCCACATCCACGGCTTCCCATACCTCGTGCAGCAGGGC
GATCAGGTGCGGCTGCCTTTTCGAATGCCTGACGTCGTCCCCGGCGATGTGCTTCGCTTGAACCGCGCGAGCGTG
CTGGGCAGTCGCGATTACACGATGAAGGGGTCGCCGCATATTGACGAGCGGCTCTTTATCTGCCGCGCTACGGTG
CTGGGGGTGGAGTCGGAGCCGATGCGCATCAAGATCAAGAAAAAGCGGCGGTGTCGGAAGAAGAAGCAGGCCAAG
TCGAAGCTTCGCTACACCATTCTGAGGATATCGGAGCTCGATATTGTGACGGCTGCGCCAGTTGATGAGGGTGCG
GCTGAGGGGAAATCGGCTGGGGAATCGGTCGAGAGCTCGAATCGAGTCGAGAAGGAAGGGTGA
Gene >Ophcf2|07363
ATGATCGACTACCCGATACCGAAGCCTCCCCCCCCGAACCCCAAGAACGCGCCCAACCCGACACGCGATCTCGTA
CGGCCCTACGCGCTGAAGAAGAGTCATCCGAACGCACCGCCCGCGCCAATTGCCGATTCGGTTAAGCATCTGCTG
CCCGTGCTGGCCGCCCAGCCGGGACACTACATCACCGTCCACATCCACGGCTTCCCATACCTCGTGCAGCAGGGC
GATCAGGTGCGGCTGCCTTTTCGAATGCCTGACGTCGTCCCCGGCGATGTGCTTCGCTTGAACCGCGCGAGCGTG
CTGGGCAGTCGCGATTACACGATGAAGGGGTCGCCGCATATTGACGAGCGGCTCTTTATCTGCCGCGCTACGGTG
CTGGGGGTGGAGTCGGAGCCGATGCGCATCAAGATCAAGAAAAAGCGGCGGTGTCGGAAGAAGAAGCAGGCCAAG
TCGAAGCTTCGCTACACCATTCTGAGGATATCGGAGCTCGATATTGTGACGGCTGCGCCAGTTGATGAGGGTGCG
GCTGAGGGGAAATCGGCTGGGGAATCGGTCGAGAGCTCGAATCGAGTCGAGAAGGAAGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail