Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07362
Gene name
Locationscaffold_09:1310041..1310882
Strand-
Gene length (bp)841
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01201 Ribosomal_S8e Ribosomal protein S8e 2.0E-42 35 259

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3451 0.6251 0.0415 0.0518 0.1343 0.0177 0.073 0.0219 0.002 0.0005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5665
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2818
Ophiocordyceps australis map64 (Brazil) OphauB2|7783
Ophiocordyceps camponoti-floridani Ophcf2|07362 (this protein)
Ophiocordyceps kimflemingae Ophio5|7078
Ophiocordyceps subramaniannii Hirsu2|8162

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07362
MPQNEYMERWRKLHGRRLDHEERTRKREAREGHKASKDAQNLRGLRAKLHQKKRHNEKIQMKKAIKAHEERNIKT
GTEKEPSTPMPSYLLDRNNPSTAKALSSAIKNKRAEKAARFSVPLPKVRGISEEEMFKVVKTGKKVQKKAWKRMV
TKPTFVGPDFTRRNPKYERFIRPMGLRYKKANVTHPELGVTVQLPIISVKKNPQNPLYTQLGVLTKGTVIEVNVS
ELGLVTAGGKVVWGRYAQVTNNPENEGCINSLLLV*
Coding >Ophcf2|07362
ATGCCGCAAAACGAGTATATGGAGAGGTGGCGCAAGCTGCACGGGCGACGGCTCGACCACGAGGAGCGGACGCGC
AAGCGAGAAGCCCGAGAAGGCCACAAGGCATCCAAAGACGCGCAGAATCTACGAGGTCTCCGAGCAAAACTTCAC
CAGAAGAAGCGCCACAACGAAAAGATCCAGATGAAGAAGGCCATCAAGGCGCACGAAGAGCGCAACATCAAGACG
GGCACTGAAAAGGAGCCATCGACGCCGATGCCATCCTACCTCCTCGACCGCAACAACCCGTCAACGGCCAAGGCG
CTCAGCAGCGCCATCAAAAACAAGCGAGCGGAAAAGGCGGCCCGTTTCAGCGTCCCCCTGCCCAAGGTGCGCGGC
ATCAGCGAGGAGGAGATGTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAAAAGGCTTGGAAGCGAATGGTG
ACGAAGCCGACCTTTGTTGGTCCGGATTTTACGCGCCGGAATCCAAAGTACGAGCGCTTCATACGGCCCATGGGC
CTGCGCTACAAAAAGGCAAACGTCACCCACCCGGAGCTGGGCGTGACGGTTCAGCTTCCCATAATCAGCGTCAAG
AAGAACCCTCAGAACCCGCTCTACACCCAGCTTGGTGTCCTGACCAAGGGCACCGTCATCGAGGTCAATGTCAGC
GAGCTGGGGCTCGTCACGGCTGGCGGAAAGGTCGTCTGGGGTCGATATGCGCAGGTTACGAACAATCCGGAGAAT
GAGGGGTGCATAAACAGCTTGCTATTGGTGTGA
Transcript >Ophcf2|07362
ATGCCGCAAAACGAGTATATGGAGAGGTGGCGCAAGCTGCACGGGCGACGGCTCGACCACGAGGAGCGGACGCGC
AAGCGAGAAGCCCGAGAAGGCCACAAGGCATCCAAAGACGCGCAGAATCTACGAGGTCTCCGAGCAAAACTTCAC
CAGAAGAAGCGCCACAACGAAAAGATCCAGATGAAGAAGGCCATCAAGGCGCACGAAGAGCGCAACATCAAGACG
GGCACTGAAAAGGAGCCATCGACGCCGATGCCATCCTACCTCCTCGACCGCAACAACCCGTCAACGGCCAAGGCG
CTCAGCAGCGCCATCAAAAACAAGCGAGCGGAAAAGGCGGCCCGTTTCAGCGTCCCCCTGCCCAAGGTGCGCGGC
ATCAGCGAGGAGGAGATGTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAAAAGGCTTGGAAGCGAATGGTG
ACGAAGCCGACCTTTGTTGGTCCGGATTTTACGCGCCGGAATCCAAAGTACGAGCGCTTCATACGGCCCATGGGC
CTGCGCTACAAAAAGGCAAACGTCACCCACCCGGAGCTGGGCGTGACGGTTCAGCTTCCCATAATCAGCGTCAAG
AAGAACCCTCAGAACCCGCTCTACACCCAGCTTGGTGTCCTGACCAAGGGCACCGTCATCGAGGTCAATGTCAGC
GAGCTGGGGCTCGTCACGGCTGGCGGAAAGGTCGTCTGGGGTCGATATGCGCAGGTTACGAACAATCCGGAGAAT
GAGGGGTGCATAAACAGCTTGCTATTGGTGTGA
Gene >Ophcf2|07362
ATGGTGAGACTCTCTGCTCGTCCATCTCCATTGACCGCTGACCATTGTCTCTGCTGCGCAGCCGCAAAACGAGTA
TATGGAGAGGTGGCGCAAGCTGCACGGGCGACGGCTCGACCACGAGGAGCGGACGCGCAAGCGAGAAGCCCGAGA
AGGCCACAAGGCATCCAAAGACGCGCAGAATCTACGAGGTCTCCGAGCAAAACTTCACCAGAAGAAGCGCCACAA
CGAAAAGATCCAGATGAAGAAGGCCATCAAGGCGCACGAAGAGCGCAACATCAAGACGGGCACTGAAAAGGAGCC
ATCGACGCCGATGCCATCCTACCTCCTCGACCGCAACAACCCGTCAACGGCCAAGGCGCTCAGCAGCGCCATCAA
AAACAAGCGAGCGGAAAAGGCGGCCCGTTTCAGCGTCCCCCTGCCCAAGGTGCGCGGCATCAGCGAGGAGGAGAT
GTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAAAAGGCTTGGAAGCGAATGGTGACGAAGCCGACCTTTGT
TGGTCCGGATTTTACGCGCCGGAATCCAAAGTACGAGCGCTTCATACGGCCCATGGGCCTGCGCTACAAAAAGGC
AAACGTCACCCACCCGGAGCTGGGCGTGACGGTTCAGCTTCCCATAATCAGCGTCAAGAAGAACCCTCAGAACCC
GCTCTACACCCAGCTTGGTGTCCTGACCAAGGGCACCGTCATCGAGGTCAATGTCAGCGAGCTGGGGCTCGTCAC
GGCTGGCGGAAAGGTCGTCTGGGGTCGATATGCGCAGGTTACGAACAATCCGGAGAATGAGGGGTGCATAAACAG
CTTGCTATTGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail