Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07361
Gene name
Locationscaffold_09:1308139..1309458
Strand-
Gene length (bp)1319
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 7.6E-11 49 125
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-09 55 132
PF13847 Methyltransf_31 Methyltransferase domain 1.6E-07 51 129
PF08241 Methyltransf_11 Methyltransferase domain 4.1E-06 56 131
PF08003 Methyltransf_9 Protein of unknown function (DUF1698) 4.8E-06 32 153

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6485 0.7189 0.0212 0.1398 0.1089 0.0032 0.0441 0.0554 0.2179 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4050
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2817
Ophiocordyceps australis map64 (Brazil) OphauB2|7782
Ophiocordyceps camponoti-floridani Ophcf2|07361 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6463
Ophiocordyceps kimflemingae Ophio5|7079
Ophiocordyceps subramaniannii Hirsu2|8164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07361
MAEEKMKALAHSEQHYFKSYDHHGIHEEMLKDEVRTRSYMNSILQNKHLFKDKIVLDVGCGTAILSMFAVKAGAK
HVIGVDMSSIVFKAREIVKANGMADKITLIQGKMEEVELPFPKVDIIISEWMGYFLLYESMLDTVLYARDAYLNK
DGLIFPDKATIYFAGIEDGDYKEEKIGFWDNVYGFNYSPLKETALSEPLVDTVELKTVVTDPTSVLTLDLYTCTT
ADLAFKAPFKLTVKRDDFIHALVAWFDIEFTACHKPIRFSTGPHTKYTHWKQTVFYFKDVLTVQRDEEVHCTLNV
RPNAKNRRDLDIEIDYELETGDLTRSAAGQCEYHMC*
Coding >Ophcf2|07361
ATGGCGGAGGAAAAAATGAAGGCGCTTGCGCACAGCGAGCAGCATTACTTTAAGAGCTATGATCATCACGGGATC
CATGAAGAGATGCTGAAAGATGAAGTGCGCACCAGATCGTACATGAACTCAATCCTCCAAAACAAGCATCTCTTC
AAAGACAAAATCGTCCTTGACGTCGGCTGCGGCACTGCTATCCTCTCCATGTTCGCCGTTAAGGCCGGCGCTAAA
CATGTCATCGGGGTCGACATGTCGTCCATCGTCTTCAAAGCCCGCGAGATCGTCAAGGCCAACGGCATGGCCGAC
AAGATTACCCTCATCCAGGGTAAGATGGAGGAGGTTGAGCTGCCATTCCCCAAGGTCGACATCATCATCTCCGAG
TGGATGGGCTACTTTTTGCTGTACGAATCCATGCTCGATACCGTTCTGTACGCTCGAGACGCCTACCTCAACAAG
GATGGCTTGATTTTCCCCGACAAGGCCACCATCTACTTCGCCGGCATCGAAGACGGCGACTACAAGGAAGAGAAG
ATCGGATTCTGGGACAACGTATACGGCTTCAACTACTCCCCCCTGAAAGAAACAGCCCTCTCAGAACCCCTCGTC
GACACCGTCGAGCTCAAAACAGTGGTAACGGACCCGACCTCAGTTCTAACCCTCGACCTGTACACCTGCACAACA
GCAGACCTCGCCTTCAAAGCCCCCTTTAAACTGACGGTCAAGCGCGACGACTTCATCCACGCCCTCGTCGCCTGG
TTCGACATAGAGTTCACCGCCTGCCACAAACCAATTCGCTTCTCGACCGGGCCCCATACAAAATACACCCACTGG
AAGCAAACCGTCTTCTACTTCAAGGACGTTCTCACCGTCCAGCGCGACGAAGAGGTCCACTGCACCCTCAACGTT
CGTCCCAACGCAAAGAACCGCCGTGACCTCGACATCGAAATCGACTACGAACTCGAAACCGGTGATCTCACCCGC
TCCGCCGCCGGCCAGTGCGAGTACCACATGTGCTGA
Transcript >Ophcf2|07361
ATGGCGGAGGAAAAAATGAAGGCGCTTGCGCACAGCGAGCAGCATTACTTTAAGAGCTATGATCATCACGGGATC
CATGAAGAGATGCTGAAAGATGAAGTGCGCACCAGATCGTACATGAACTCAATCCTCCAAAACAAGCATCTCTTC
AAAGACAAAATCGTCCTTGACGTCGGCTGCGGCACTGCTATCCTCTCCATGTTCGCCGTTAAGGCCGGCGCTAAA
CATGTCATCGGGGTCGACATGTCGTCCATCGTCTTCAAAGCCCGCGAGATCGTCAAGGCCAACGGCATGGCCGAC
AAGATTACCCTCATCCAGGGTAAGATGGAGGAGGTTGAGCTGCCATTCCCCAAGGTCGACATCATCATCTCCGAG
TGGATGGGCTACTTTTTGCTGTACGAATCCATGCTCGATACCGTTCTGTACGCTCGAGACGCCTACCTCAACAAG
GATGGCTTGATTTTCCCCGACAAGGCCACCATCTACTTCGCCGGCATCGAAGACGGCGACTACAAGGAAGAGAAG
ATCGGATTCTGGGACAACGTATACGGCTTCAACTACTCCCCCCTGAAAGAAACAGCCCTCTCAGAACCCCTCGTC
GACACCGTCGAGCTCAAAACAGTGGTAACGGACCCGACCTCAGTTCTAACCCTCGACCTGTACACCTGCACAACA
GCAGACCTCGCCTTCAAAGCCCCCTTTAAACTGACGGTCAAGCGCGACGACTTCATCCACGCCCTCGTCGCCTGG
TTCGACATAGAGTTCACCGCCTGCCACAAACCAATTCGCTTCTCGACCGGGCCCCATACAAAATACACCCACTGG
AAGCAAACCGTCTTCTACTTCAAGGACGTTCTCACCGTCCAGCGCGACGAAGAGGTCCACTGCACCCTCAACGTT
CGTCCCAACGCAAAGAACCGCCGTGACCTCGACATCGAAATCGACTACGAACTCGAAACCGGTGATCTCACCCGC
TCCGCCGCCGGCCAGTGCGAGTACCACATGTGCTGA
Gene >Ophcf2|07361
ATGGCGGAGGAAAAAATGAAGGCGCTTGCGCACAGCGAGCAGCATTACTTTAAGAGGTTTGTCTCGGAGGTGGGG
AGTGTCTTTGACGTCTGAGATGCTGACTTGGTGGTTCTAGCTATGATCATCACGGTATGTCTTCTCTTTCGTCTG
ATTGTTCTGGTTGGCTTGCGCTGATGGTTTTGAATCGCAGGGATCCATGAAGAGATGCTGGTATGTCTTTTTCAG
ACTCCTTTCTCGACATGACTGGATAGCTGACCCGATCCGATAGAAAGATGAAGTGCGCACCAGATCGTACATGAA
CTCAATCCTCCAAAACAAGCATCTCTTCAAAGACAAAATCGTCCTTGACGTCGGCTGCGGCACTGCTATCCTCTC
CATGTACCTTTACCCCCCCCCCCCACCCCTCCCCACCCATCCAACGGTGAAAAGACAACTGACGCCGACTCGCAG
GTTCGCCGTTAAGGCCGGCGCTAAACATGTCATCGGGGTCGACATGTCGTCCATCGTCTTCAAAGCCCGCGAGAT
CGTCAAGGCCAACGGCATGGCCGACAAGATTACCCTCATCCAGGGTAAGATGGAGGAGGTTGAGCTGCCATTCCC
CAAGGTCGACATCATCATCTCCGAGTGGATGGGCTACTTTTTGCTGTACGAATCCATGCTCGATACCGTTCTGTA
CGCTCGAGACGCCTACCTCAACAAGGATGGCTTGATTTTCCCCGACAAGGCCACCATCTACTTCGCCGGCATCGA
AGACGGCGACTACAAGGAAGAGAAGATCGGATGTAAGATGCTACCCTTCCCCCCTTTCCAAACGACCCTAGCTAA
CCCGCTGTCGCGAAGTCTGGGACAACGTATACGGCTTCAACTACTCCCCCCTGAAAGAAACAGCCCTCTCAGAAC
CCCTCGTCGACACCGTCGAGCTCAAAACAGTGGTAACGGACCCGACCTCAGTTCTAACCCTCGACCTGTACACCT
GCACAACAGCAGACCTCGCCTTCAAAGCCCCCTTTAAACTGACGGTCAAGCGCGACGACTTCATCCACGCCCTCG
TCGCCTGGTTCGACATAGAGTTCACCGCCTGCCACAAACCAATTCGCTTCTCGACCGGGCCCCATACAAAATACA
CCCACTGGAAGCAAACCGTCTTCTACTTCAAGGACGTTCTCACCGTCCAGCGCGACGAAGAGGTCCACTGCACCC
TCAACGTTCGTCCCAACGCAAAGAACCGCCGTGACCTCGACATCGAAATCGACTACGAACTCGAAACCGGTGATC
TCACCCGCTCCGCCGCCGGCCAGTGCGAGTACCACATGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail