Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07356
Gene name
Locationscaffold_09:1299259..1300052
Strand+
Gene length (bp)793
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05773 RWD RWD domain 1.0E-19 4 114
PF16543 DFRP_C DRG Family Regulatory Proteins, Tma46 2.5E-07 132 218

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6662 0.5751 0.0061 0.062 0.1028 0.0031 0.0918 0.0589 0.1269 0.0018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1930
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2812
Ophiocordyceps australis map64 (Brazil) OphauB2|7777
Ophiocordyceps camponoti-floridani Ophcf2|07356 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6571
Ophiocordyceps kimflemingae Ophio5|6656
Ophiocordyceps subramaniannii Hirsu2|2063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07356
MPHEEQIEERQVLESIFPDEITDISETEFRISVTLDTDASPPPPRLLLHVRYPEAYPDVAPHLDLLAHPDDESRH
AYLSVVDDRDQLLADLEAAVQENIGIAMVFTLVSALRDAAEALVQKRIDDEANVRHEALLAAEREENSKFHGTPV
TPESFRDWRRAFRAEMEEQSRKDEEHRLAELKRAKIKEPVKLLTGRQLWERGLAGKIEDEDEDDDADSAVPTKGL
EKLQVEPS*
Coding >Ophcf2|07356
ATGCCTCACGAGGAGCAGATCGAGGAGAGACAAGTCCTAGAGTCCATATTTCCCGACGAAATCACCGACATCTCC
GAGACCGAATTCCGAATCAGCGTCACCCTAGACACCGACGCCTCCCCTCCTCCCCCCCGACTCCTCCTCCACGTC
CGCTATCCAGAAGCCTACCCAGACGTGGCCCCTCATCTCGACCTCCTCGCCCATCCCGACGATGAGTCGCGCCAC
GCCTACCTCAGCGTCGTCGACGACCGCGACCAGCTCCTCGCAGATCTCGAAGCCGCCGTACAGGAAAATATCGGC
ATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCAGAAACGTATCGATGAC
GAGGCTAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAATAGCAAGTTTCACGGCACCCCCGTC
ACGCCTGAATCCTTCCGTGATTGGCGTCGTGCCTTTCGCGCCGAGATGGAGGAGCAGAGTCGCAAGGACGAGGAG
CATCGTCTTGCTGAGCTCAAGAGGGCCAAGATCAAGGAGCCGGTTAAGCTCCTCACCGGCAGGCAGCTCTGGGAG
CGCGGCCTCGCCGGCAAGATCGAAGACGAAGACGAAGACGACGATGCCGACTCTGCCGTCCCGACCAAGGGCCTG
GAGAAGCTGCAGGTCGAGCCGTCGTGA
Transcript >Ophcf2|07356
ATGCCTCACGAGGAGCAGATCGAGGAGAGACAAGTCCTAGAGTCCATATTTCCCGACGAAATCACCGACATCTCC
GAGACCGAATTCCGAATCAGCGTCACCCTAGACACCGACGCCTCCCCTCCTCCCCCCCGACTCCTCCTCCACGTC
CGCTATCCAGAAGCCTACCCAGACGTGGCCCCTCATCTCGACCTCCTCGCCCATCCCGACGATGAGTCGCGCCAC
GCCTACCTCAGCGTCGTCGACGACCGCGACCAGCTCCTCGCAGATCTCGAAGCCGCCGTACAGGAAAATATCGGC
ATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCAGAAACGTATCGATGAC
GAGGCTAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAATAGCAAGTTTCACGGCACCCCCGTC
ACGCCTGAATCCTTCCGTGATTGGCGTCGTGCCTTTCGCGCCGAGATGGAGGAGCAGAGTCGCAAGGACGAGGAG
CATCGTCTTGCTGAGCTCAAGAGGGCCAAGATCAAGGAGCCGGTTAAGCTCCTCACCGGCAGGCAGCTCTGGGAG
CGCGGCCTCGCCGGCAAGATCGAAGACGAAGACGAAGACGACGATGCCGACTCTGCCGTCCCGACCAAGGGCCTG
GAGAAGCTGCAGGTCGAGCCGTCGTGA
Gene >Ophcf2|07356
ATGCCTCACGAGGAGCAGATCGAGGAGAGACAAGTCCTAGAGTCCATATTTCCCGACGAAATCACCGGTAATGTT
CCATCCTATTCACTCTTCACCACTCCAACGCAGCCAGCTCCAGCTTCACTCCTCCAATCCAATAATCTAACTCGC
TGCCCCAGACATCTCCGAGACCGAATTCCGAATCAGCGTCACCCTAGACACCGACGCCTCCCCTCCTCCCCCCCG
ACTCCTCCTCCACGTCCGCTATCCAGAAGCCTACCCAGACGTGGCCCCTCATCTCGACCTCCTCGCCCATCCCGA
CGATGAGTCGCGCCACGCCTACCTCAGCGTCGTCGACGACCGCGACCAGCTCCTCGCAGATCTCGAAGCCGCCGT
ACAGGAAAATATCGGCATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCA
GAAACGTATCGATGACGAGGCTAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAATAGCAAGTT
TCACGGCACCCCCGTCACGCCTGAATCCTTCCGTGATTGGCGTCGTGCCTTTCGCGCCGAGATGGAGGAGCAGAG
TCGCAAGGACGAGGAGCATCGTCTTGCTGAGCTCAAGAGGGCCAAGATCAAGGAGCCGGTTAAGCTCCTCACCGG
CAGGCAGCTCTGGGAGCGCGGCCTCGCCGGCAAGATCGAAGACGAAGACGAAGACGACGATGCCGACTCTGCCGT
CCCGACCAAGGGCCTGGAGAAGCTGCAGGTCGAGCCGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail