Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07344
Gene name
Locationscaffold_09:1270661..1271870
Strand-
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01137 RTC RNA 3'-terminal phosphate cyclase 6.4E-26 10 350
PF05189 RTC_insert RNA 3'-terminal phosphate cyclase (RTC), insert domain 1.7E-25 208 319

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2662 0.9177 0.0041 0.1121 0.3766 0.018 0.0312 0.169 0.0169 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4066
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4048
Ophiocordyceps australis map64 (Brazil) OphauB2|4933
Ophiocordyceps camponoti-floridani Ophcf2|07344 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|860
Ophiocordyceps kimflemingae Ophio5|1523
Ophiocordyceps subramaniannii Hirsu2|8198

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07344
MSSSTEFIRFIGHTAFSRRLTIATLLGRPVHISKIRVSSPTSPGLAPHHISFLRLLEAVTNGSSIQISFTGTTIT
YRPGLITGTVAGEGATEGDVIVHNIPESNTRGVTYYLLPLCLLAPFSKAHMNVRFSGPGVITSATEEGDVSVDTF
RTAIIPLFDLFGIPPARIEIRVLQRSCPGPEGRGGGGCVELRFASQVRLPRTLHLHRDPGRIKRIRGVAYSTGVS
ASNNSRMIQAAREKLKFFCADIHVAAQYDQAPLVAAGKEGEKRRLGIGFGLSLVAESSTAGIFYSADMVTPSTGN
TVPEEIGRNCVSQLLESIKLGGCVSHVSSPIVLVLMSMGSEDVGRLRIAEGVFATHNHVRLARDLRMFGAHPWAL
RDAGNKAHDIIVTVKGAGVGNVGRKMA*
Coding >Ophcf2|07344
ATGTCGTCGAGCACCGAGTTCATACGTTTCATCGGCCACACCGCCTTCAGTCGGCGCTTGACAATCGCCACCCTT
CTCGGTCGTCCGGTTCACATATCCAAGATCCGCGTCTCGTCGCCCACCAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCTTTCACAGGCACCACCATCACG
TATCGTCCCGGTTTGATAACGGGAACCGTCGCCGGTGAGGGCGCCACCGAAGGCGACGTGATTGTGCACAACATT
CCCGAGTCTAACACGAGGGGCGTGACATATTATCTACTACCGCTGTGCCTGCTGGCGCCTTTCTCCAAGGCGCAC
ATGAACGTTCGCTTTTCGGGACCGGGTGTCATTACCTCTGCCACCGAGGAGGGCGACGTCTCCGTCGACACGTTC
CGGACCGCCATCATACCCCTCTTCGACCTATTCGGCATCCCGCCCGCGAGGATCGAAATCAGGGTGCTGCAACGG
TCCTGCCCCGGCCCCGAAGGCCGAGGCGGCGGTGGTTGCGTCGAGTTACGCTTTGCGAGCCAAGTCCGGCTGCCC
AGGACGCTGCATCTTCATCGAGACCCCGGTCGAATCAAGAGGATTAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGGCTGCCCGCGAAAAACTAAAGTTCTTTTGCGCCGACATCCATGTGGCC
GCGCAATACGATCAGGCCCCATTGGTGGCCGCGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGCTTCGGA
CTGAGCTTGGTGGCCGAGTCGAGCACTGCTGGCATCTTCTATTCGGCAGATATGGTGACTCCTTCAACGGGTAAT
ACTGTACCCGAAGAAATCGGAAGAAATTGTGTGAGCCAGCTGCTCGAGTCGATCAAGCTGGGCGGCTGCGTGAGC
CACGTTTCTAGCCCCATCGTCTTGGTCCTCATGTCCATGGGTTCGGAAGACGTCGGACGTCTAAGAATAGCCGAG
GGCGTTTTCGCGACACATAATCATGTGCGGCTGGCGAGGGACCTGCGGATGTTCGGCGCGCATCCCTGGGCGTTG
AGAGACGCGGGGAACAAAGCCCATGATATCATTGTCACTGTCAAGGGAGCCGGCGTCGGCAACGTAGGCAGAAAG
ATGGCATAA
Transcript >Ophcf2|07344
ATGTCGTCGAGCACCGAGTTCATACGTTTCATCGGCCACACCGCCTTCAGTCGGCGCTTGACAATCGCCACCCTT
CTCGGTCGTCCGGTTCACATATCCAAGATCCGCGTCTCGTCGCCCACCAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCTTTCACAGGCACCACCATCACG
TATCGTCCCGGTTTGATAACGGGAACCGTCGCCGGTGAGGGCGCCACCGAAGGCGACGTGATTGTGCACAACATT
CCCGAGTCTAACACGAGGGGCGTGACATATTATCTACTACCGCTGTGCCTGCTGGCGCCTTTCTCCAAGGCGCAC
ATGAACGTTCGCTTTTCGGGACCGGGTGTCATTACCTCTGCCACCGAGGAGGGCGACGTCTCCGTCGACACGTTC
CGGACCGCCATCATACCCCTCTTCGACCTATTCGGCATCCCGCCCGCGAGGATCGAAATCAGGGTGCTGCAACGG
TCCTGCCCCGGCCCCGAAGGCCGAGGCGGCGGTGGTTGCGTCGAGTTACGCTTTGCGAGCCAAGTCCGGCTGCCC
AGGACGCTGCATCTTCATCGAGACCCCGGTCGAATCAAGAGGATTAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGGCTGCCCGCGAAAAACTAAAGTTCTTTTGCGCCGACATCCATGTGGCC
GCGCAATACGATCAGGCCCCATTGGTGGCCGCGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGCTTCGGA
CTGAGCTTGGTGGCCGAGTCGAGCACTGCTGGCATCTTCTATTCGGCAGATATGGTGACTCCTTCAACGGGTAAT
ACTGTACCCGAAGAAATCGGAAGAAATTGTGTGAGCCAGCTGCTCGAGTCGATCAAGCTGGGCGGCTGCGTGAGC
CACGTTTCTAGCCCCATCGTCTTGGTCCTCATGTCCATGGGTTCGGAAGACGTCGGACGTCTAAGAATAGCCGAG
GGCGTTTTCGCGACACATAATCATGTGCGGCTGGCGAGGGACCTGCGGATGTTCGGCGCGCATCCCTGGGCGTTG
AGAGACGCGGGGAACAAAGCCCATGATATCATTGTCACTGTCAAGGGAGCCGGCGTCGGCAACGTAGGCAGAAAG
ATGGCATAA
Gene >Ophcf2|07344
ATGTCGTCGAGCACCGAGTTCATACGTTTCATCGGCCACACCGCCTTCAGTCGGCGCTTGACAATCGCCACCCTT
CTCGGTCGTCCGGTTCACATATCCAAGATCCGCGTCTCGTCGCCCACCAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCTTTCACAGGCACCACCATCACG
TATCGTCCCGGTTTGATAACGGGAACCGTCGCCGGTGAGGGCGCCACCGAAGGCGACGTGATTGTGCACAACATT
CCCGAGTCTAACACGAGGGGCGTGACATATTATCTACTACCGCTGTGCCTGCTGGCGCCTTTCTCCAAGGCGCAC
ATGAACGTTCGCTTTTCGGGACCGGGTGTCATTACCTCTGCCACCGAGGAGGGCGACGTCTCCGTCGACACGTTC
CGGACCGCCATCATACCCCTCTTCGACCTATTCGGCATCCCGCCCGCGAGGATCGAAATCAGGGTGCTGCAACGG
TCCTGCCCCGGCCCCGAAGGCCGAGGCGGCGGTGGTTGCGTCGAGTTACGCTTTGCGAGCCAAGTCCGGCTGCCC
AGGACGCTGCATCTTCATCGAGACCCCGGTCGAATCAAGAGGATTAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGGCTGCCCGCGAAAAACTAAAGTTCTTTTGCGCCGACATCCATGTGGCC
GCGCAATACGATCAGGCCCCATTGGTGGCCGCGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGCTTCGGA
CTGAGCTTGGTGGCCGAGTCGAGCACTGCTGGCATCTTCTATTCGGCAGATATGGTGACTCCTTCAACGGGTAAT
ACTGTACCCGAAGAAATCGGAAGAAATTGTGTGAGCCAGCTGCTCGAGTCGATCAAGCTGGGCGGCTGCGTGAGC
CACGTTTCTAGCCCCATCGTCTTGGTCCTCATGTCCATGGGTTCGGAAGACGTCGGACGTCTAAGAATAGCCGAG
GGCGTTTTCGCGACACATAATCATGTGCGGCTGGCGAGGGACCTGCGGATGTTCGGCGCGCATCCCTGGGCGTTG
AGAGACGCGGGGAACAAAGCCCATGATATCATTGTCACTGTCAAGGGAGCCGGCGTCGGCAACGTAGGCAGAAAG
ATGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail