Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07335
Gene name
Locationscaffold_09:1247574..1250200
Strand+
Gene length (bp)2626
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20497 SWI-SNF_Ssr4_C SWI/SNF and RSC complexes subunit Ssr4 C-terminal 1.8E-100 262 565
PF20497 SWI-SNF_Ssr4_C SWI/SNF and RSC complexes subunit Ssr4 C-terminal 3.3E-06 578 720
PF20497 SWI-SNF_Ssr4_C SWI/SNF and RSC complexes subunit Ssr4 C-terminal 7.4E-22 701 816
PF08549 SWI-SNF_Ssr4_N SWI/SNF and RSC complexes subunit Ssr4 N-terminal 5.3E-100 4 213

GO

GO Term Description Terminal node
GO:0006338 chromatin remodeling Yes
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006325 chromatin organization No
GO:0016043 cellular component organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3941 0.9636 0.1582 0.0244 0.0529 0.0006 0.0253 0.0132 0.0093 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4073
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6803
Ophiocordyceps australis map64 (Brazil) OphauB2|3024
Ophiocordyceps camponoti-floridani Ophcf2|07335 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5598
Ophiocordyceps kimflemingae Ophio5|8378
Ophiocordyceps subramaniannii Hirsu2|8213

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07335
MAQQDPSHSVPQDLMPHVHLISAFRYPTMPRLDVNEVAKWLMNAPSVARDRAPFFWTYLDKPTDGTILLTWQPLQ
RLGTNFATDGFVWAPPEHIYKHDLGNGLMLEIYYLKSGYMIGEQHALHARRRFRLVPVPGHPNPPQPDTSLFIVH
YGPSEPNDRIPSAAVPYDERVNAIMQQRHYLLRAGQLRRKEFMLSDRVNWPSLPELTRQQMGPQMVPRGVPQQMA
YPAQPGVHGPPIKRARHGGSLQGGQQPVMSAMAEQAFEDEEDVARGDMFDTLTQRDISLSRYQQNHEWMEEILSS
AYCMNQITPADLNLGLKGELASLTEGIFTAQGADVLARTPEKPYIGRLDKGLADEFKKRVEEHRTSTLAEMERMR
IAHEAAMAEFGKKSIYAVKELELRAMGREESSPLANGESGQEEEEGKAGNRRQRFTKTAEEVAKEVEAATGRKIV
GLPLVRRLNQGGYQSQSQSQAAAAAAAAAAPNAEAQMSRQQSGAGSHNSGLDDVDMGGTAAGLLDQMHTGFSSMS
TPANSFPTPQAQMSAAQSNVATPLNGPGVSSPAPTSTANAGAGAEAGAGAGAAAATATAATSATAAATAATAAAA
SAPAASAAAAAAAAADTAADTAVVPPQAEDVAMEGTAETATKEEKTAPDDGTGSEEWVVVPKSGEPSSTSTSDPP
APITRTSTSSPKPTPPPPTQNPPSSSSTTTTAKPEPEPEPEPEQPQQQPQQQQQPQSQQQQQSQQLQLQLPPATT
SAAATPASATFDQNDFSSLGDLDTAADALSGFDAPDLDGAAGELGDGLDLQMDIEDSAFGEAFHGGGDSRRGADL
*
Coding >Ophcf2|07335
ATGGCGCAACAGGACCCCAGCCACAGCGTCCCTCAGGACCTGATGCCGCATGTGCACCTCATCTCAGCCTTTCGC
TACCCGACGATGCCGCGGCTCGACGTCAACGAGGTGGCAAAGTGGCTGATGAACGCGCCTTCGGTGGCTCGCGAT
CGCGCTCCCTTCTTCTGGACCTACCTCGATAAGCCGACGGACGGCACCATCCTTCTGACCTGGCAGCCGCTGCAG
AGGCTGGGCACCAACTTTGCCACCGATGGCTTTGTCTGGGCGCCGCCTGAGCATATATACAAGCATGACTTGGGC
AATGGGCTGATGCTCGAGATCTACTATCTCAAGTCCGGTTACATGATAGGCGAACAGCATGCCCTCCACGCGCGC
CGACGCTTCCGACTCGTTCCCGTCCCGGGCCATCCCAACCCGCCTCAGCCCGACACGAGCCTCTTCATCGTCCAT
TACGGCCCGTCCGAGCCCAACGACCGCATCCCCTCGGCGGCGGTCCCCTACGACGAGCGCGTCAACGCCATCATG
CAGCAGCGCCACTATCTCTTGCGCGCGGGCCAGTTACGCCGCAAGGAGTTTATGCTCTCCGACCGCGTCAACTGG
CCCTCGCTGCCAGAGCTCACGCGCCAGCAGATGGGACCGCAGATGGTGCCGCGCGGCGTGCCTCAGCAGATGGCC
TATCCGGCTCAGCCTGGCGTACATGGCCCGCCCATCAAGCGTGCTCGTCATGGAGGGTCGTTGCAGGGGGGGCAG
CAGCCCGTAATGTCGGCCATGGCCGAGCAGGCGTTTGAGGATGAGGAGGACGTTGCCAGGGGGGACATGTTTGAT
ACGCTGACGCAACGCGACATCTCGTTGAGCCGTTATCAGCAAAATCACGAGTGGATGGAGGAGATCTTGTCGTCG
GCCTACTGCATGAATCAGATCACGCCCGCCGATCTCAACCTGGGTCTCAAGGGGGAGCTGGCGTCGCTGACCGAG
GGTATCTTTACCGCCCAGGGCGCCGACGTGCTCGCCCGGACGCCCGAGAAGCCCTACATCGGTCGTCTGGACAAG
GGACTTGCCGACGAGTTCAAGAAGCGAGTCGAGGAGCACAGGACGTCGACGCTGGCCGAGATGGAAAGGATGCGC
ATCGCCCACGAAGCAGCCATGGCCGAATTCGGCAAAAAGTCCATCTACGCCGTCAAAGAGCTGGAGCTGAGGGCC
ATGGGTCGGGAGGAGTCTTCGCCCCTGGCCAACGGGGAATCAGGACAAGAAGAGGAGGAGGGCAAGGCAGGCAAC
AGGCGGCAACGCTTCACCAAGACGGCCGAAGAGGTGGCCAAGGAGGTCGAAGCCGCTACGGGACGCAAGATTGTC
GGACTGCCTCTGGTCAGACGCCTTAACCAGGGAGGCTACCAGTCGCAATCGCAATCGCAGGCAGCAGCAGCAGCA
GCAGCAGCAGCAGCGCCCAACGCCGAGGCGCAAATGTCGCGACAGCAATCGGGCGCGGGATCGCACAACAGCGGC
TTGGATGACGTCGACATGGGCGGCACTGCGGCTGGGCTGCTGGATCAGATGCATACGGGCTTCTCGTCCATGTCG
ACGCCTGCGAACAGCTTCCCTACGCCTCAGGCTCAGATGTCGGCTGCGCAGTCGAACGTGGCGACGCCCCTGAAT
GGACCCGGGGTATCGTCGCCTGCGCCCACTTCGACTGCTAATGCTGGAGCTGGGGCTGAGGCTGGGGCTGGGGCT
GGGGCTGCCGCTGCTACTGCCACTGCGGCCACTTCTGCCACTGCTGCTGCCACTGCTGCCACTGCTGCTGCTGCT
TCTGCCCCTGCTGCTTCTGCTGCTGCTGCCGCTGCTGCTGCTGCTGATACTGCTGCTGATACTGCCGTCGTTCCT
CCGCAGGCTGAGGATGTCGCCATGGAGGGAACGGCTGAGACGGCGACCAAGGAGGAAAAGACGGCGCCGGATGAT
GGAACCGGCAGCGAAGAATGGGTGGTAGTTCCCAAGAGCGGAGAGCCATCCTCGACTTCAACCTCGGATCCTCCA
GCCCCTATAACCAGAACGTCAACCTCATCCCCCAAACCAACACCACCACCTCCCACGCAAAACCCGCCCTCTTCC
TCATCCACCACCACCACCGCCAAACCCGAACCCGAACCCGAACCCGAACCCGAACAACCCCAACAACAACCCCAA
CAACAACAACAACCCCAATCCCAACAACAACAACAATCACAACAACTACAACTACAACTACCCCCAGCAACAACC
TCAGCAGCCGCAACCCCCGCCTCAGCAACCTTTGACCAAAACGACTTCAGCTCCCTCGGCGACCTCGACACCGCC
GCCGACGCCCTCTCCGGCTTCGACGCCCCGGACCTCGACGGCGCAGCGGGCGAGTTGGGCGATGGCCTGGACCTT
CAGATGGATATCGAGGATTCGGCTTTCGGGGAGGCTTTTCATGGAGGGGGGGACTCCCGGCGAGGGGCCGATCTT
TAA
Transcript >Ophcf2|07335
ATGGCGCAACAGGACCCCAGCCACAGCGTCCCTCAGGACCTGATGCCGCATGTGCACCTCATCTCAGCCTTTCGC
TACCCGACGATGCCGCGGCTCGACGTCAACGAGGTGGCAAAGTGGCTGATGAACGCGCCTTCGGTGGCTCGCGAT
CGCGCTCCCTTCTTCTGGACCTACCTCGATAAGCCGACGGACGGCACCATCCTTCTGACCTGGCAGCCGCTGCAG
AGGCTGGGCACCAACTTTGCCACCGATGGCTTTGTCTGGGCGCCGCCTGAGCATATATACAAGCATGACTTGGGC
AATGGGCTGATGCTCGAGATCTACTATCTCAAGTCCGGTTACATGATAGGCGAACAGCATGCCCTCCACGCGCGC
CGACGCTTCCGACTCGTTCCCGTCCCGGGCCATCCCAACCCGCCTCAGCCCGACACGAGCCTCTTCATCGTCCAT
TACGGCCCGTCCGAGCCCAACGACCGCATCCCCTCGGCGGCGGTCCCCTACGACGAGCGCGTCAACGCCATCATG
CAGCAGCGCCACTATCTCTTGCGCGCGGGCCAGTTACGCCGCAAGGAGTTTATGCTCTCCGACCGCGTCAACTGG
CCCTCGCTGCCAGAGCTCACGCGCCAGCAGATGGGACCGCAGATGGTGCCGCGCGGCGTGCCTCAGCAGATGGCC
TATCCGGCTCAGCCTGGCGTACATGGCCCGCCCATCAAGCGTGCTCGTCATGGAGGGTCGTTGCAGGGGGGGCAG
CAGCCCGTAATGTCGGCCATGGCCGAGCAGGCGTTTGAGGATGAGGAGGACGTTGCCAGGGGGGACATGTTTGAT
ACGCTGACGCAACGCGACATCTCGTTGAGCCGTTATCAGCAAAATCACGAGTGGATGGAGGAGATCTTGTCGTCG
GCCTACTGCATGAATCAGATCACGCCCGCCGATCTCAACCTGGGTCTCAAGGGGGAGCTGGCGTCGCTGACCGAG
GGTATCTTTACCGCCCAGGGCGCCGACGTGCTCGCCCGGACGCCCGAGAAGCCCTACATCGGTCGTCTGGACAAG
GGACTTGCCGACGAGTTCAAGAAGCGAGTCGAGGAGCACAGGACGTCGACGCTGGCCGAGATGGAAAGGATGCGC
ATCGCCCACGAAGCAGCCATGGCCGAATTCGGCAAAAAGTCCATCTACGCCGTCAAAGAGCTGGAGCTGAGGGCC
ATGGGTCGGGAGGAGTCTTCGCCCCTGGCCAACGGGGAATCAGGACAAGAAGAGGAGGAGGGCAAGGCAGGCAAC
AGGCGGCAACGCTTCACCAAGACGGCCGAAGAGGTGGCCAAGGAGGTCGAAGCCGCTACGGGACGCAAGATTGTC
GGACTGCCTCTGGTCAGACGCCTTAACCAGGGAGGCTACCAGTCGCAATCGCAATCGCAGGCAGCAGCAGCAGCA
GCAGCAGCAGCAGCGCCCAACGCCGAGGCGCAAATGTCGCGACAGCAATCGGGCGCGGGATCGCACAACAGCGGC
TTGGATGACGTCGACATGGGCGGCACTGCGGCTGGGCTGCTGGATCAGATGCATACGGGCTTCTCGTCCATGTCG
ACGCCTGCGAACAGCTTCCCTACGCCTCAGGCTCAGATGTCGGCTGCGCAGTCGAACGTGGCGACGCCCCTGAAT
GGACCCGGGGTATCGTCGCCTGCGCCCACTTCGACTGCTAATGCTGGAGCTGGGGCTGAGGCTGGGGCTGGGGCT
GGGGCTGCCGCTGCTACTGCCACTGCGGCCACTTCTGCCACTGCTGCTGCCACTGCTGCCACTGCTGCTGCTGCT
TCTGCCCCTGCTGCTTCTGCTGCTGCTGCCGCTGCTGCTGCTGCTGATACTGCTGCTGATACTGCCGTCGTTCCT
CCGCAGGCTGAGGATGTCGCCATGGAGGGAACGGCTGAGACGGCGACCAAGGAGGAAAAGACGGCGCCGGATGAT
GGAACCGGCAGCGAAGAATGGGTGGTAGTTCCCAAGAGCGGAGAGCCATCCTCGACTTCAACCTCGGATCCTCCA
GCCCCTATAACCAGAACGTCAACCTCATCCCCCAAACCAACACCACCACCTCCCACGCAAAACCCGCCCTCTTCC
TCATCCACCACCACCACCGCCAAACCCGAACCCGAACCCGAACCCGAACCCGAACAACCCCAACAACAACCCCAA
CAACAACAACAACCCCAATCCCAACAACAACAACAATCACAACAACTACAACTACAACTACCCCCAGCAACAACC
TCAGCAGCCGCAACCCCCGCCTCAGCAACCTTTGACCAAAACGACTTCAGCTCCCTCGGCGACCTCGACACCGCC
GCCGACGCCCTCTCCGGCTTCGACGCCCCGGACCTCGACGGCGCAGCGGGCGAGTTGGGCGATGGCCTGGACCTT
CAGATGGATATCGAGGATTCGGCTTTCGGGGAGGCTTTTCATGGAGGGGGGGACTCCCGGCGAGGGGCCGATCTT
TAA
Gene >Ophcf2|07335
ATGGCGCAACAGGACCCCAGCCACAGCGTCCCTCAGGACCTGGTACGCGCCCTGCCCTTGTCACCCCCCCCCCCC
CAAAGCCCGAATATCTGATGCTAAAAGTCGACAGATGCCGCATGTGCACCTCATCTCAGCCTTTCGCTACCCGAC
GATGCCGCGGCTCGACGTCAACGAGGTGGCAAAGTGGCTGATGAACGCGCCTTCGGTGGCTCGCGATCGCGCTCC
CTTCTTCTGGACCTACCTCGATAAGCCGACGGACGGCACCATCCTTCTGACCTGGCAGCCGCTGCAGAGGCTGGG
CACCAACTTTGCCACCGATGGCTTTGTCTGGGCGCCGCCTGAGCATATATACAAGCATGACTTGGGCAATGGGCT
GGTGAGGGTGACCGTCTCTTGGCTGTTGTCTTGTTTGGCTGACTTTTTCTCTCTCTTTCTCTCTCTCTCTCTCTC
TCTTCAGATGCTCGAGATCTACTATCTCAAGTCCGGTTACATGATAGGCGAACAGCATGCCCTCCACGCGCGCCG
ACGCTTCCGACTCGTTCCCGTCCCGGGCCATCCCAACCCGCCTCAGCCCGACACGAGCCTCTTCATCGTCCATTA
CGGCCCGTCCGAGCCCAACGACCGCATCCCCTCGGCGGCGGTCCCCTACGACGAGCGCGTCAACGCCATCATGCA
GCAGCGCCACTATCTCTTGCGCGCGGGCCAGTTACGCCGCAAGGAGTTTATGCTCTCCGACCGCGTCAACTGGCC
CTCGCTGCCAGAGCTCACGCGCCAGCAGATGGGACCGCAGATGGTGCCGCGCGGCGTGCCTCAGCAGATGGCCTA
TCCGGCTCAGCCTGGCGTACATGGCCCGCCCATCAAGCGTGCTCGTCATGGAGGGTCGTTGCAGGGGGGGCAGCA
GCCCGTAATGTCGGCCATGGCCGAGCAGGCGTTTGAGGATGAGGAGGACGTTGCCAGGGGGGACATGTTTGATAC
GCTGACGCAACGCGACATCTCGTTGAGCCGTTATCAGCAAAATCACGAGTGGATGGAGGAGATCTTGTCGTCGGC
CTACTGCATGAATCAGATCACGCCCGCCGATCTCAACCTGGGTCTCAAGGGGGAGCTGGCGTCGCTGACCGAGGG
TATCTTTACCGCCCAGGGCGCCGACGTGCTCGCCCGGACGCCCGAGAAGCCCTACATCGGTCGTCTGGACAAGGG
ACTTGCCGACGAGTTCAAGAAGCGAGTCGAGGAGCACAGGACGTCGACGCTGGCCGAGATGGAAAGGATGCGCAT
CGCCCACGAAGCAGCCATGGCCGAATTCGGCAAAAAGTCCATCTACGCCGTCAAAGAGCTGGAGCTGAGGGCCAT
GGGTCGGGAGGAGTCTTCGCCCCTGGCCAACGGGGAATCAGGACAAGAAGAGGAGGAGGGCAAGGCAGGCAACAG
GCGGCAACGCTTCACCAAGACGGCCGAAGAGGTGGCCAAGGAGGTCGAAGCCGCTACGGGACGCAAGATTGTCGG
ACTGCCTCTGGTCAGACGCCTTAACCAGGGAGGCTACCAGTCGCAATCGCAATCGCAGGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCGCCCAACGCCGAGGCGCAAATGTCGCGACAGCAATCGGGCGCGGGATCGCACAACAGCGGCTT
GGATGACGTCGACATGGGCGGCACTGCGGCTGGGCTGCTGGATCAGATGCATACGGGCTTCTCGTCCATGTCGAC
GCCTGCGAACAGCTTCCCTACGCCTCAGGCTCAGATGTCGGCTGCGCAGTCGAACGTGGCGACGCCCCTGAATGG
ACCCGGGGTATCGTCGCCTGCGCCCACTTCGACTGCTAATGCTGGAGCTGGGGCTGAGGCTGGGGCTGGGGCTGG
GGCTGCCGCTGCTACTGCCACTGCGGCCACTTCTGCCACTGCTGCTGCCACTGCTGCCACTGCTGCTGCTGCTTC
TGCCCCTGCTGCTTCTGCTGCTGCTGCCGCTGCTGCTGCTGCTGATACTGCTGCTGATACTGCCGTCGTTCCTCC
GCAGGCTGAGGATGTCGCCATGGAGGGAACGGCTGAGACGGCGACCAAGGAGGAAAAGACGGCGCCGGATGATGG
AACCGGCAGCGAAGAATGGGTGGTAGTTCCCAAGAGCGGAGAGCCATCCTCGACTTCAACCTCGGATCCTCCAGC
CCCTATAACCAGAACGTCAACCTCATCCCCCAAACCAACACCACCACCTCCCACGCAAAACCCGCCCTCTTCCTC
ATCCACCACCACCACCGCCAAACCCGAACCCGAACCCGAACCCGAACCCGAACAACCCCAACAACAACCCCAACA
ACAACAACAACCCCAATCCCAACAACAACAACAATCACAACAACTACAACTACAACTACCCCCAGCAACAACCTC
AGCAGCCGCAACCCCCGCCTCAGCAACCTTTGACCAAAACGACTTCAGCTCCCTCGGCGACCTCGACACCGCCGC
CGACGCCCTCTCCGGCTTCGACGCCCCGGACCTCGACGGCGCAGCGGGCGAGTTGGGCGATGGCCTGGACCTTCA
GATGGATATCGAGGATTCGGCTTTCGGGGAGGCTTTTCATGGAGGGGGGGACTCCCGGCGAGGGGCCGATCTTTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail