Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07332
Gene name
Locationscaffold_09:1240017..1241737
Strand+
Gene length (bp)1720
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 3.4E-19 117 430

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 112 131 19
2 146 168 22
3 200 219 19
4 229 251 22
5 258 275 17
6 279 301 22
7 314 336 22
8 356 378 22
9 385 407 22
10 411 432 21

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07332
MEPVVGHRRRKSSLIHPVGGHRARLSITIPHDSPDDQAERPFDAVKPDPASDSDSSADDSHPDEEMGLSTKDRSR
RRRSRRRNRRLDNRIAREKDVSAAELREADHDVLRRLVINGIFGLLWFMFSLSISLYNKWMFDRDRLNFAFPLFT
TSMHMLVQFALAGLVLYFVPSLRPQQSHNSDGGRSRHETEPNSSVMSKMFYLTRIGPCGAATGLDIGLGNASLKF
ISLTFYTMCKSSSLAFVLLFAFLFRLETPTWRLVAIIAIMIMGVILMVFGEVEFKLGGFVLVISAAFFSGFRWGL
TQILLLRNPATSNPFSSIFFLSPVMFVTLLSLAIPVEGFGPLWAGLKALSDEWGTVMTPLFLLFPGCIAFLMTAS
EFALLQRTSVVTLSIVGIFKEVVTISAASIVFHDRLTLINIVGLITTMAAIVAYNYIKITKMRQDARVDVHGRHA
EPGPLSPSSPVGSASEGLDADDEAEETAGLLHQTQQAEPAPALVTSDGDIQPNLLVPPHHAAPTEADDRRQGRVA
*
Coding >Ophcf2|07332
ATGGAGCCCGTCGTCGGCCATCGGCGGCGGAAGAGTAGCCTCATCCATCCCGTCGGCGGTCATCGCGCTCGCCTC
TCCATCACCATCCCTCATGACTCGCCGGACGACCAAGCCGAACGTCCCTTCGATGCCGTCAAGCCCGATCCAGCC
AGCGATAGCGACAGCAGCGCCGATGACTCCCATCCCGACGAGGAGATGGGTCTGTCCACAAAGGATCGCAGCCGC
AGACGGAGGTCGCGTCGGAGGAATAGGCGGCTGGATAACCGCATCGCCCGCGAAAAGGATGTGTCGGCCGCCGAG
CTGAGGGAGGCTGACCATGACGTTCTGAGACGGCTGGTCATCAATGGAATCTTCGGCCTGCTGTGGTTCATGTTC
TCTCTGTCCATCTCTCTCTATAATAAATGGATGTTTGACCGCGATCGCCTCAACTTTGCCTTTCCGCTCTTCACC
ACCTCGATGCACATGCTGGTCCAATTCGCCTTGGCCGGCCTCGTCCTCTACTTCGTACCTTCGCTGAGGCCTCAA
CAGTCGCACAACTCGGACGGCGGCCGTTCGCGGCACGAGACGGAGCCCAACAGCTCCGTCATGTCCAAGATGTTC
TACCTGACGCGCATCGGACCTTGCGGCGCCGCCACGGGGCTCGACATTGGGCTCGGCAACGCGTCGCTCAAGTTC
ATCAGCCTCACCTTTTACACCATGTGCAAATCCTCGTCCCTTGCCTTCGTCCTTCTCTTCGCCTTCCTTTTCCGC
CTCGAAACGCCGACGTGGCGTCTCGTAGCCATCATAGCCATCATGATCATGGGCGTCATCCTCATGGTCTTTGGC
GAGGTCGAGTTCAAGCTCGGTGGCTTCGTCCTCGTCATCTCGGCCGCCTTCTTCTCCGGCTTCCGCTGGGGCCTG
ACGCAGATTCTACTGCTGCGCAATCCGGCCACGTCTAACCCCTTTTCTAGCATCTTCTTCCTCTCGCCCGTCATG
TTCGTCACCCTCCTCTCGCTCGCCATTCCCGTCGAGGGCTTCGGCCCGCTCTGGGCAGGCCTCAAGGCGCTGAGC
GACGAATGGGGTACCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGCTGCATCGCCTTCCTCATGACGGCTTCC
GAGTTCGCTTTGCTGCAGCGCACTTCAGTCGTTACCCTCTCCATCGTGGGCATCTTCAAGGAGGTCGTCACCATC
TCGGCTGCCTCCATCGTCTTCCACGACCGCCTCACGCTCATCAACATCGTCGGCCTAATCACCACCATGGCCGCC
ATCGTCGCTTACAATTATATCAAGATCACAAAGATGCGCCAGGACGCTCGAGTCGACGTTCACGGCAGACACGCC
GAGCCGGGCCCGCTCTCGCCTTCCAGCCCGGTTGGCAGCGCCAGCGAGGGGCTCGACGCCGATGACGAGGCCGAG
GAGACCGCCGGCCTGCTGCATCAGACGCAGCAAGCCGAGCCGGCTCCTGCGCTCGTCACCTCGGATGGCGACATT
CAGCCTAACCTGCTGGTGCCTCCGCACCACGCGGCACCGACCGAGGCCGACGACCGGAGGCAAGGTCGTGTGGCC
TGA
Transcript >Ophcf2|07332
ATGGAGCCCGTCGTCGGCCATCGGCGGCGGAAGAGTAGCCTCATCCATCCCGTCGGCGGTCATCGCGCTCGCCTC
TCCATCACCATCCCTCATGACTCGCCGGACGACCAAGCCGAACGTCCCTTCGATGCCGTCAAGCCCGATCCAGCC
AGCGATAGCGACAGCAGCGCCGATGACTCCCATCCCGACGAGGAGATGGGTCTGTCCACAAAGGATCGCAGCCGC
AGACGGAGGTCGCGTCGGAGGAATAGGCGGCTGGATAACCGCATCGCCCGCGAAAAGGATGTGTCGGCCGCCGAG
CTGAGGGAGGCTGACCATGACGTTCTGAGACGGCTGGTCATCAATGGAATCTTCGGCCTGCTGTGGTTCATGTTC
TCTCTGTCCATCTCTCTCTATAATAAATGGATGTTTGACCGCGATCGCCTCAACTTTGCCTTTCCGCTCTTCACC
ACCTCGATGCACATGCTGGTCCAATTCGCCTTGGCCGGCCTCGTCCTCTACTTCGTACCTTCGCTGAGGCCTCAA
CAGTCGCACAACTCGGACGGCGGCCGTTCGCGGCACGAGACGGAGCCCAACAGCTCCGTCATGTCCAAGATGTTC
TACCTGACGCGCATCGGACCTTGCGGCGCCGCCACGGGGCTCGACATTGGGCTCGGCAACGCGTCGCTCAAGTTC
ATCAGCCTCACCTTTTACACCATGTGCAAATCCTCGTCCCTTGCCTTCGTCCTTCTCTTCGCCTTCCTTTTCCGC
CTCGAAACGCCGACGTGGCGTCTCGTAGCCATCATAGCCATCATGATCATGGGCGTCATCCTCATGGTCTTTGGC
GAGGTCGAGTTCAAGCTCGGTGGCTTCGTCCTCGTCATCTCGGCCGCCTTCTTCTCCGGCTTCCGCTGGGGCCTG
ACGCAGATTCTACTGCTGCGCAATCCGGCCACGTCTAACCCCTTTTCTAGCATCTTCTTCCTCTCGCCCGTCATG
TTCGTCACCCTCCTCTCGCTCGCCATTCCCGTCGAGGGCTTCGGCCCGCTCTGGGCAGGCCTCAAGGCGCTGAGC
GACGAATGGGGTACCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGCTGCATCGCCTTCCTCATGACGGCTTCC
GAGTTCGCTTTGCTGCAGCGCACTTCAGTCGTTACCCTCTCCATCGTGGGCATCTTCAAGGAGGTCGTCACCATC
TCGGCTGCCTCCATCGTCTTCCACGACCGCCTCACGCTCATCAACATCGTCGGCCTAATCACCACCATGGCCGCC
ATCGTCGCTTACAATTATATCAAGATCACAAAGATGCGCCAGGACGCTCGAGTCGACGTTCACGGCAGACACGCC
GAGCCGGGCCCGCTCTCGCCTTCCAGCCCGGTTGGCAGCGCCAGCGAGGGGCTCGACGCCGATGACGAGGCCGAG
GAGACCGCCGGCCTGCTGCATCAGACGCAGCAAGCCGAGCCGGCTCCTGCGCTCGTCACCTCGGATGGCGACATT
CAGCCTAACCTGCTGGTGCCTCCGCACCACGCGGCACCGACCGAGGCCGACGACCGGAGGCAAGGTCGTGTGGCC
TGA
Gene >Ophcf2|07332
ATGGAGCCCGTCGTCGGCCATCGGCGGCGGAAGAGTAGCCTCATCCATCCCGTCGGCGGTCATCGCGCTCGCCTC
TCCATCACCATCCCTCATGACTCGCCGGACGACCAAGCCGAACGTCCCTTCGATGCCGTCAAGCCCGATCCAGCC
AGCGATAGCGACAGCAGCGCCGATGACTCCCATCCCGACGAGGAGATGGGTCTGTCCACAAAGGATCGCAGCCGC
AGACGGAGGTCGCGTCGGAGGAATAGGCGGCTGGATAACCGCATCGCCCGCGAAAAGGATGTGTCGGCCGCCGAG
CTGAGGGAGGCTGACCATGACGTTCTGAGACGGCTGGTCATCAATGGAATCTTCGGCCTGCTGTGGTTCATGTTC
TCTCTGTCCATCTCTCTCGTACGTCCCCCAACTGATTCCTCTCCCTTTTTTCTCCTTCTACCCGGACGATGCGCT
GACGAGGCTGGAACCGCAGTATAATAAATGGATGTTTGACCGCGATCGCCTCAACTTTGCCTTTCCGCTCTTCAC
CACCTCGATGCACATGCTGGTCCAATTCGCCTTGGCCGGCCTCGTCCTCTACTTCGTACCTTCGCTGAGGCCTCA
ACAGTCGCACAACTCGGACGGCGGCCGTTCGCGGCACGAGACGGAGCCCAACAGCTCCGTCATGTCCAAGATGTT
CTACCTGACGCGCATCGGACCTTGCGGCGCCGCCACGGGGCTCGACATTGGGCTCGGCAACGCGTCGCTCAAGTT
CATCAGCCTCACCTTTTACAGTCAGTTTCCCCTTGTTTCAACCATCTCGTACCCCTTCTTGTCCTTTGCTGACTC
TTCGCTTCCAGCCATGTGCAAATCCTCGTCCCTTGCCTTCGTCCTTCTCTTCGCCTTCCTTTTCCGCCTCGAAAC
GCCGACGTGGCGTCTCGTAGCCATCATAGCCATCATGATCATGGGCGTCATCCTCATGGTCTTTGGCGAGGTCGA
GTTCAAGCTCGGTGGCTTCGTCCTCGTCATCTCGGCCGCCTTCTTCTCCGGCTTCCGCTGGGGCCTGACGCAGAT
TCTACTGCTGCGCAATCCGGCCACGTCTAACCCCTTTTCTAGCATCTTCTTCCTCTCGCCCGTCATGTTCGTCAC
CCTCCTCTCGCTCGCCATTCCCGTCGAGGGCTTCGGCCCGCTCTGGGCAGGCCTCAAGGCGCTGAGCGACGAATG
GGGTACCGTCATGACGCCGCTCTTCCTCCTCTTCCCCGGCTGCATCGCCTTCCTCATGACGGCTTCCGAGTTCGC
TTTGCTGCAGCGCACTTCAGTCGTTACCCTCTCCATCGTGGGCATCTTCAAGGAGGTCGTCACCATCTCGGCTGC
CTCCATCGTCTTCCACGACCGCCTCACGCTCATCAACATCGTCGGCCTAATCACCACCATGGCCGCCATCGTCGC
TTACAATTATATCAAGATCACAAAGATGCGCCAGGACGCTCGAGTCGACGTTCACGGCAGACACGCCGAGCCGGG
CCCGCTCTCGCCTTCCAGCCCGGTTGGCAGCGCCAGCGAGGGGCTCGACGCCGATGACGAGGCCGAGGAGACCGC
CGGCCTGCTGCATCAGACGCAGCAAGCCGAGCCGGCTCCTGCGCTCGTCACCTCGGATGGCGACATTCAGCCTAA
CCTGCTGGTGCCTCCGCACCACGCGGCACCGACCGAGGCCGACGACCGGAGGCAAGGTCGTGTGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail