Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07326
Gene name
Locationscaffold_09:1230629..1231050
Strand+
Gene length (bp)421
Transcript length (bp)246
Coding sequence length (bp)246
Protein length (aa) 82

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 2.1E-23 3 74
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 8.0E-13 2 71

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4552 0.7288 0.2639 0.1614 0.1102 0.0025 0.2811 0.1106 0.1273 0.0066

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5782
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5449
Ophiocordyceps australis map64 (Brazil) OphauB2|3015
Ophiocordyceps camponoti-floridani Ophcf2|07326 (this protein)
Ophiocordyceps kimflemingae Ophio5|8369
Ophiocordyceps subramaniannii Hirsu2|9672

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07326
MLIKVRTLTGKEIDLDIEMNYKVSQIKEKVEEKEGIPPVQQRLIHGGKQMTDEKTAADYGLSAGETLHLVLALRG
GDLSTC*
Coding >Ophcf2|07326
ATGTTAATCAAAGTCCGGACGTTGACGGGCAAGGAGATTGACCTCGATATTGAGATGAATTACAAGGTCTCGCAG
ATTAAGGAAAAGGTTGAGGAGAAGGAGGGTATTCCGCCCGTGCAGCAGCGTCTCATCCACGGCGGGAAACAAATG
ACGGACGAAAAGACGGCGGCAGATTACGGTCTGAGCGCGGGCGAGACGCTGCATCTGGTCCTTGCTCTCAGGGGG
GGCGACTTGTCGACCTGCTGA
Transcript >Ophcf2|07326
ATGTTAATCAAAGTCCGGACGTTGACGGGCAAGGAGATTGACCTCGATATTGAGATGAATTACAAGGTCTCGCAG
ATTAAGGAAAAGGTTGAGGAGAAGGAGGGTATTCCGCCCGTGCAGCAGCGTCTCATCCACGGCGGGAAACAAATG
ACGGACGAAAAGACGGCGGCAGATTACGGTCTGAGCGCGGGCGAGACGCTGCATCTGGTCCTTGCTCTCAGGGGG
GGCGACTTGTCGACCTGCTGA
Gene >Ophcf2|07326
ATGTTAATCAAGTAACGTCTTCCCCATGACGGGGGGGGGGGGGACTCGAGGTTGGCCGTGGTCGTGCTTGCTGAT
GGGTGTAGAGTCCGGACGTTGACGGGCAAGGAGATTGACCTCGATATTGAGATGAATTACAAGGTACGCGGATGG
CTTTGGACTGGCTGGGGAGGGGGGGACTTACGGGGTTTAGGTCTCGCAGATTAAGGAAAAGGTTGAGGAGAAGGA
GGGTATTCCGCCCGTGCAGCAGCGTCTCATCCACGGCGGGAAACAAATGTCACCTACCCCCCCAACAATCTACAG
GCAGAGTTCTAATCGGCCTCGCAGGACGGACGAAAAGACGGCGGCAGATTACGGTCTGAGCGCGGGCGAGACGCT
GCATCTGGTCCTTGCTCTCAGGGGGGGCGACTTGTCGACCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail