Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07325
Gene name
Locationscaffold_09:1228974..1230028
Strand+
Gene length (bp)1054
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 1.4E-22 58 235

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Endoplasmic reticulum Transmembrane domain 0.2319 0.2221 0.2068 0.4203 0.6387 0.0487 0.6512 0.2831 0.37 0.0037

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup157
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5450
Ophiocordyceps australis 1348a (Ghana) OphauG2|7625
Ophiocordyceps australis map64 (Brazil) OphauB2|3014
Ophiocordyceps australis map64 (Brazil) OphauB2|5252
Ophiocordyceps camponoti-floridani Ophcf2|01279
Ophiocordyceps camponoti-floridani Ophcf2|07325 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2335
Ophiocordyceps camponoti-rufipedis Ophun1|4433
Ophiocordyceps kimflemingae Ophio5|1059
Ophiocordyceps kimflemingae Ophio5|8368
Ophiocordyceps subramaniannii Hirsu2|11089
Ophiocordyceps subramaniannii Hirsu2|2047

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07325
MSNWQDDAMQKMASRFRRMQQMNAGGPGGGVPQRAFLSTLAMGILLGGGVALANSLFNVDGGHRAIKYRRIGGVS
KEIYSEGTHINIPWFETPIVYDVRARPRNVASLTGTKDLQMVNITCRVLSRPQVEALPQIYRTLGADYDERVLPS
IVNEVLKSVVAQFNASQLITQREMVARLVRENLSRRAARFNILLDDVSLTHLAFSPEFTAAVEAKQVAQQEAQRA
AFVVDKARQEKQAMVVKAQGEARSAELIGEAIKKNQAYAELKKIENARLIAQQLQEAGAQNRLLLDSEGLGLNVF
EQSPSSSGKN*
Coding >Ophcf2|07325
ATGAGCAACTGGCAGGATGATGCGATGCAAAAGATGGCTTCTCGGTTCCGCCGAATGCAGCAGATGAACGCCGGC
GGCCCGGGCGGTGGGGTTCCGCAGAGGGCCTTTCTGAGCACCTTGGCCATGGGCATTCTGCTGGGCGGGGGCGTC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGTGGTCATCGGGCTATCAAGTATCGCAGGATTGGCGGTGTGAGC
AAGGAGATTTACTCTGAAGGAACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGACGTGCGAGCG
CGGCCGCGTAACGTGGCGTCCCTGACGGGCACCAAGGACCTCCAGATGGTCAACATTACCTGCCGCGTCTTGTCC
CGGCCGCAGGTCGAGGCGTTGCCGCAAATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCC
ATTGTCAACGAGGTGCTCAAGAGCGTCGTTGCGCAGTTTAACGCCAGTCAACTCATCACGCAGCGTGAGATGGTG
GCTCGGCTCGTGCGAGAGAACTTGTCGCGTCGAGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACG
CATCTCGCCTTCTCGCCCGAGTTTACGGCCGCCGTCGAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGGGCG
GCTTTTGTCGTCGACAAGGCGCGGCAGGAGAAGCAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGAGGTCGGCG
GAGCTCATTGGCGAGGCCATCAAGAAGAACCAGGCGTACGCGGAGCTCAAGAAGATTGAGAACGCTCGTCTCATT
GCGCAGCAGTTGCAGGAGGCCGGTGCGCAGAACAGGCTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTT
GAGCAGTCGCCGTCGTCGTCGGGGAAGAATTAG
Transcript >Ophcf2|07325
ATGAGCAACTGGCAGGATGATGCGATGCAAAAGATGGCTTCTCGGTTCCGCCGAATGCAGCAGATGAACGCCGGC
GGCCCGGGCGGTGGGGTTCCGCAGAGGGCCTTTCTGAGCACCTTGGCCATGGGCATTCTGCTGGGCGGGGGCGTC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGTGGTCATCGGGCTATCAAGTATCGCAGGATTGGCGGTGTGAGC
AAGGAGATTTACTCTGAAGGAACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGACGTGCGAGCG
CGGCCGCGTAACGTGGCGTCCCTGACGGGCACCAAGGACCTCCAGATGGTCAACATTACCTGCCGCGTCTTGTCC
CGGCCGCAGGTCGAGGCGTTGCCGCAAATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCC
ATTGTCAACGAGGTGCTCAAGAGCGTCGTTGCGCAGTTTAACGCCAGTCAACTCATCACGCAGCGTGAGATGGTG
GCTCGGCTCGTGCGAGAGAACTTGTCGCGTCGAGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACG
CATCTCGCCTTCTCGCCCGAGTTTACGGCCGCCGTCGAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGGGCG
GCTTTTGTCGTCGACAAGGCGCGGCAGGAGAAGCAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGAGGTCGGCG
GAGCTCATTGGCGAGGCCATCAAGAAGAACCAGGCGTACGCGGAGCTCAAGAAGATTGAGAACGCTCGTCTCATT
GCGCAGCAGTTGCAGGAGGCCGGTGCGCAGAACAGGCTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTT
GAGCAGTCGCCGTCGTCGTCGGGGAAGAATTAG
Gene >Ophcf2|07325
ATGAGCAACTGGCAGGATGATGCGATGCAAAAGATGGCTTCTCGGTTCCGCCGAATGCAGCAGATGAACGCCGGC
GGCCCGGGCGGTGGGGTTCCGCAGAGGGCCTTTCTGAGCACCTTGGCCATGGGCATTCTGCTGGGCGGGGGCGTC
GCCTTGGCCAACTCGCTGTTCAACGTTGATGGTGGTCATCGGGCTATCAAGTATCGCAGGATTGGCGGTGTGAGC
AAGGAGATTTACTCTGAAGGTTCGACTCGGCTCGAGAGTAAGAAGGGTCAGTCGAGAGGGCTGACAAGTAGTCGA
CAGGAACGCACATCAACATCCCCTGGTTCGAGACGCCCATCGTCTACGACGTGCGAGCGCGGCCGCGTAACGTGG
CGTCCCTGACGGGCACCAAGGACCTCCAGATGGTCAACATTACCTGCCGCGTCTTGTCCCGGCCGCAGGTCGAGG
CGTTGCCGCAAATCTACCGCACGCTGGGCGCCGACTACGACGAGCGGGTTCTTCCGTCCATTGTCAACGAGGTGC
TCAAGAGCGTCGTTGCGCAGTTTAACGCCAGTCAACTCATCACGCAGCGTGAGATGGTGGCTCGGCTCGTGCGAG
AGAACTTGTCGCGTCGAGCGGCGCGCTTCAACATCTTGCTCGACGACGTTTCGCTGACGGTAGGTCTCAATACCG
AGTTATACCGAGTCAAGCGCCCGACTGACCGTCTTCGTCTGTGTAGCATCTCGCCTTCTCGCCCGAGTTTACGGC
CGCCGTCGAAGCCAAGCAGGTGGCGCAGCAGGAGGCCCAGCGGGCGGCTTTTGTCGTCGACAAGGCGCGGCAGGA
GAAGCAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGAGGTCGGCGGAGCTCATTGGCGAGGCCATCAAGAAGAA
CCAGGCGTACGCGGAGCTCAAGAAGATTGAGAACGCTCGTCTCATTGCGCAGCAGTTGCAGGAGGCCGGTGCGCA
GAACAGGCTGCTTCTGGATTCTGAGGGTCTGGGTCTCAATGTGTTTGAGCAGTCGCCGTCGTCGTCGGGGAAGAA
TTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail