Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07321
Gene name
Locationscaffold_09:1221113..1222055
Strand-
Gene length (bp)942
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13519 VWA_2 von Willebrand factor type A domain 9.6E-27 6 116
PF00092 VWA von Willebrand factor type A domain 6.3E-11 6 158
PF04056 Ssl1 Ssl1-like 1.2E-07 9 139

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6793 0.733 0.0087 0.1358 0.1392 0.0215 0.2474 0.0788 0.2423 0.0081

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6118
Ophiocordyceps australis map64 (Brazil) OphauB2|2646
Ophiocordyceps camponoti-floridani Ophcf2|07321 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4437
Ophiocordyceps kimflemingae Ophio5|8364
Ophiocordyceps subramaniannii Hirsu2|2057

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07321
MVLEAVMVVVDNSESSRNGDYQPTRFDAQVDAVNVLFQSITQGNPESSVGLMSMGGKGPEVLVTLTTEQGKILEG
LHRTKKNIGGSSHLNTGIQVAALALKHRQNRLQRQRIIVFVCSPVEEEEKELIALAKKMKKSNFSIDFILFGDLD
DDKTQKKLQAFNDAVKGNEGSHMVVVPPSGKLLSDQLVATPILLGDNASGPGGSGGMGGGEEEEFEFGFDPAMEP
ELALALRMSMEEEKARQEKRAREEEEVAKKASLEGVKEEDEASGSGTKSDQQGGSKKDDGGDKMDTS*
Coding >Ophcf2|07321
ATGGTGCTCGAAGCCGTCATGGTTGTCGTGGACAACAGCGAGAGCAGCAGAAACGGCGACTACCAGCCGACTCGC
TTCGACGCCCAGGTAGACGCCGTCAATGTACTGTTCCAGAGCATCACGCAAGGAAACCCGGAGTCGTCGGTCGGC
CTGATGAGCATGGGCGGCAAGGGCCCCGAAGTCCTCGTCACCCTGACCACGGAGCAGGGCAAGATACTCGAAGGC
CTACACCGGACAAAGAAGAATATTGGCGGATCATCGCATCTCAATACGGGTATTCAAGTTGCCGCGCTCGCCCTC
AAGCACCGACAGAATCGGCTGCAGAGGCAGCGAATAATAGTCTTTGTCTGCTCGCCGGTAGAGGAGGAGGAAAAG
GAGCTCATAGCGCTGGCAAAAAAGATGAAAAAGTCCAATTTCTCCATCGACTTCATCTTATTCGGCGACCTCGAC
GACGACAAGACGCAGAAGAAGCTGCAAGCCTTCAACGACGCCGTCAAGGGCAACGAGGGCTCGCACATGGTGGTC
GTCCCTCCAAGCGGCAAGTTGCTGAGCGACCAGCTCGTCGCGACGCCCATCCTGCTGGGCGACAACGCATCCGGA
CCCGGCGGCTCCGGCGGCATGGGTGGCGGTGAGGAGGAGGAGTTCGAGTTTGGCTTCGATCCGGCTATGGAGCCG
GAACTGGCCCTCGCTCTGCGCATGAGCATGGAAGAGGAAAAGGCCAGGCAGGAGAAGCGGGCGCGGGAGGAGGAA
GAGGTGGCCAAAAAGGCCTCCTTGGAGGGTGTCAAGGAAGAGGACGAGGCCAGCGGTAGCGGGACAAAGAGTGAC
CAGCAGGGAGGTAGCAAAAAGGACGACGGAGGCGACAAGATGGACACGTCGTAG
Transcript >Ophcf2|07321
ATGGTGCTCGAAGCCGTCATGGTTGTCGTGGACAACAGCGAGAGCAGCAGAAACGGCGACTACCAGCCGACTCGC
TTCGACGCCCAGGTAGACGCCGTCAATGTACTGTTCCAGAGCATCACGCAAGGAAACCCGGAGTCGTCGGTCGGC
CTGATGAGCATGGGCGGCAAGGGCCCCGAAGTCCTCGTCACCCTGACCACGGAGCAGGGCAAGATACTCGAAGGC
CTACACCGGACAAAGAAGAATATTGGCGGATCATCGCATCTCAATACGGGTATTCAAGTTGCCGCGCTCGCCCTC
AAGCACCGACAGAATCGGCTGCAGAGGCAGCGAATAATAGTCTTTGTCTGCTCGCCGGTAGAGGAGGAGGAAAAG
GAGCTCATAGCGCTGGCAAAAAAGATGAAAAAGTCCAATTTCTCCATCGACTTCATCTTATTCGGCGACCTCGAC
GACGACAAGACGCAGAAGAAGCTGCAAGCCTTCAACGACGCCGTCAAGGGCAACGAGGGCTCGCACATGGTGGTC
GTCCCTCCAAGCGGCAAGTTGCTGAGCGACCAGCTCGTCGCGACGCCCATCCTGCTGGGCGACAACGCATCCGGA
CCCGGCGGCTCCGGCGGCATGGGTGGCGGTGAGGAGGAGGAGTTCGAGTTTGGCTTCGATCCGGCTATGGAGCCG
GAACTGGCCCTCGCTCTGCGCATGAGCATGGAAGAGGAAAAGGCCAGGCAGGAGAAGCGGGCGCGGGAGGAGGAA
GAGGTGGCCAAAAAGGCCTCCTTGGAGGGTGTCAAGGAAGAGGACGAGGCCAGCGGTAGCGGGACAAAGAGTGAC
CAGCAGGGAGGTAGCAAAAAGGACGACGGAGGCGACAAGATGGACACGTCGTAG
Gene >Ophcf2|07321
ATGGTGCTCGAAGCCGTCATGGTTGTCGTGGACAACAGCGAGAGCAGCAGAAACGGCGACTACCAGCCGACTCGC
TTCGACGCCCAGGTAGACGCCGTCAATGTACTGTTCCAGAGCATCACGCAAGGAAACCCGGAGTCGTCGGTCGGC
CTGATGAGCATGGGCGGCAAGGGCCCCGAAGTCCTCGTCACCCTGACCACGGAGCAGGGCAAGATACTCGAAGGC
CTACACCGGACAAAGAAGAATATTGGCGGATCATCGCATCTCAATACGGGTATTCAAGTTGCCGCGGTAAGATCT
ACTCCTTTGCCGCCCCTTTCTTCTCTTTGGTACCCATCAACTGACGGACTGCAGCTCGCCCTCAAGCACCGACAG
AATCGGCTGCAGAGGCAGCGAATAATAGTCTTTGTCTGCTCGCCGGTAGAGGAGGAGGAAAAGGAGCTCATAGCG
CTGGCAAAAAAGATGAAAAAGTCCAATTTCTCCATCGACTTCATCTTATTCGGCGACCTCGACGACGACAAGACG
CAGAAGAAGCTGCAAGCCTTCAACGACGCCGTCAAGGGCAACGAGGGCTCGCACATGGTGGTCGTCCCTCCAAGC
GGCAAGTTGCTGAGCGACCAGCTCGTCGCGACGCCCATCCTGCTGGGCGACAACGCATCCGGACCCGGCGGCTCC
GGCGGCATGGGTGGCGGTGAGGAGGAGGAGTTCGAGTTTGGCTTCGATCCGGCTATGGAGCCGGAACTGGCCCTC
GCTCTGCGCATGAGCATGGAAGAGGAAAAGGCCAGGCAGGAGAAGCGGGCGCGGGAGGAGGAAGAGGTGGCCAAA
AAGGCCTCCTTGGAGGGTGTCAAGGAAGAGGACGAGGCCAGCGGTAGCGGGACAAAGAGTGACCAGCAGGGAGGT
AGCAAAAAGGACGACGGAGGCGACAAGATGGACACGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail