Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07320
Gene name
Locationscaffold_09:1220187..1221012
Strand+
Gene length (bp)825
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 4.2E-54 16 166
PF04628 Sedlin_N Sedlin, N-terminal conserved region 9.1E-07 93 162

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0030008 TRAPP complex Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0005575 cellular_component No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0048193 Golgi vesicle transport No
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0140535 intracellular protein-containing complex No
GO:0099023 vesicle tethering complex No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 10 31 21

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07320
MVELDELQPYWFAMTVFSLIIINKAGGLVYNKTFHEGGLNKITTNDYLVLAGTFHGIHAITARLNPVKPARPASN
PPSTPNLHQRPEPSSGLEVLETENFRMQCFNTLTGTKFLLFTDTTQVNVDLTLRRIYDLYSDYVMKNPFYSLEMP
IRCEIFDRKLLSYIREINNR*
Coding >Ophcf2|07320
ATGGTCGAGCTGGACGAACTTCAACCATACTGGTTCGCCATGACCGTCTTCTCCCTCATCATCATCAACAAGGCC
GGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGTCTCAACAAGATCACCACAAACGACTACCTCGTTCTC
GCCGGCACATTTCACGGCATCCACGCCATCACCGCCCGCCTCAACCCCGTCAAGCCCGCACGCCCAGCTTCGAAC
CCCCCGTCGACACCGAACCTCCACCAGCGGCCGGAGCCGTCGTCAGGCCTCGAGGTTCTAGAGACGGAGAACTTT
CGCATGCAGTGCTTCAATACCCTCACCGGCACCAAATTTCTGCTCTTCACCGATACCACGCAGGTTAATGTCGAT
CTGACGCTGAGGAGGATATACGATCTGTATTCCGACTACGTCATGAAGAATCCTTTCTACTCGCTAGAGATGCCC
ATCCGGTGCGAAATCTTTGACCGGAAACTGCTCTCCTACATTAGAGAGATCAATAATCGTTGA
Transcript >Ophcf2|07320
ATGGTCGAGCTGGACGAACTTCAACCATACTGGTTCGCCATGACCGTCTTCTCCCTCATCATCATCAACAAGGCC
GGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGTCTCAACAAGATCACCACAAACGACTACCTCGTTCTC
GCCGGCACATTTCACGGCATCCACGCCATCACCGCCCGCCTCAACCCCGTCAAGCCCGCACGCCCAGCTTCGAAC
CCCCCGTCGACACCGAACCTCCACCAGCGGCCGGAGCCGTCGTCAGGCCTCGAGGTTCTAGAGACGGAGAACTTT
CGCATGCAGTGCTTCAATACCCTCACCGGCACCAAATTTCTGCTCTTCACCGATACCACGCAGGTTAATGTCGAT
CTGACGCTGAGGAGGATATACGATCTGTATTCCGACTACGTCATGAAGAATCCTTTCTACTCGCTAGAGATGCCC
ATCCGGTGCGAAATCTTTGACCGGAAACTGCTCTCCTACATTAGAGAGATCAATAATCGTTGA
Gene >Ophcf2|07320
ATGGTCGAGGTTTGCGGTGCGCAAAAGCGCGAGGCGCTGCTTGGTGATGGGTTGGAGGTGGAGCGAGGCTGAGGC
TGACTGGGCTGTGGGGCGGAGTCAGTCGTAGCCTCGTTATATGGTAGGGCGGTGGCAGCCTTGCTGTGGGCGCTG
ACTCACGTTGTAGCTGGACGAACTTCAACCATGTTCGTCGCCGGCTGAGAGGTTCGTTGCCCTCGAAGAGCGGGA
ATTGAAGACTGGTTCGCCATGTAAGTTTGATGTACGACAATACGTTCTTGTCGTATCTTGCTCATCGTCGCTTAG
GACCGTCTTCTCCCTCATCATCATCAACAAGGCCGGCGGCTTAGTCTACAACAAGACCTTTCACGAAGGCGGTCT
CAACAAGATCACCACAAACGACTACCTCGTTCTCGCCGGCACATTTCACGGGTAGAGCAGCTATTCTTCTCTTCG
CTTCAAGCTCCCCCCGCTCACTCCCCCAGCATCCACGCCATCACCGCCCGCCTCAACCCCGTCAAGCCCGCACGC
CCAGCTTCGAACCCCCCGTCGACACCGAACCTCCACCAGCGGCCGGAGCCGTCGTCAGGCCTCGAGGTTCTAGAG
ACGGAGAACTTTCGCATGCAGTGCTTCAATACCCTCACCGGCACCAAATTTCTGCTCTTCACCGATACCACGCAG
GTTAATGTCGATCTGACGCTGAGGAGGATATACGATCTGTATTCCGACTACGTCATGAAGAATCCTTTCTACTCG
CTAGAGATGCCCATCCGGTGCGAAATCTTTGACCGGAAACTGCTCTCCTACATTAGAGAGATCAATAATCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail