Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07309
Gene name
Locationscaffold_09:1193635..1194730
Strand+
Gene length (bp)1095
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06201 PITH PITH domain 2.6E-34 140 300
PF00085 Thioredoxin Thioredoxin 1.2E-12 10 107

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7472 0.7196 0.066 0.0224 0.0621 0.0022 0.2984 0.0975 0.0943 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3003
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7329
Ophiocordyceps australis map64 (Brazil) OphauB2|4911
Ophiocordyceps camponoti-floridani Ophcf2|07309 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4452
Ophiocordyceps kimflemingae Ophio5|879
Ophiocordyceps subramaniannii Hirsu2|5153

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07309
MSSSPSIQISSAEQFQDLLQSSKVVVAGFYGNDTSGFGRMTAPLYETLSQSLSRPDTITFVTIDKDKNAQLADTY
AVTELPTFLLFRDAAVINKAQGPDPKGLQDLVKNLASQVQSLGEDADMASVWRGAEVTRGFSDITDQVEVRGCEL
LNSHQDAGPVKVLFDGSKPSALGDEQPSSKDWVQSGADDQLLLFMPFQSSIKLHTLQLTSLPPKDQTEVSRPEVI
QLFVNQPRNMDFSEADDTEPTQTITLAANDWNSDGTINVGLRYVKFQKTTSLIIYVQKGADDAETVRLDRVRLVG
DFGLKREMGKLQKIGQGQ*
Coding >Ophcf2|07309
ATGTCTTCTAGCCCGTCCATTCAAATATCTTCTGCGGAGCAGTTTCAAGACCTCCTTCAGTCGTCCAAGGTCGTT
GTCGCCGGCTTTTATGGAAACGATACTTCTGGTTTCGGACGCATGACAGCTCCGCTCTACGAAACGCTGTCCCAG
TCGCTGTCCCGCCCCGATACCATCACCTTTGTCACCATCGACAAGGACAAGAATGCGCAGCTCGCCGACACATAC
GCAGTGACGGAGCTCCCCACCTTTCTACTCTTTCGAGACGCCGCCGTCATCAACAAGGCTCAAGGTCCTGACCCA
AAAGGGCTGCAAGATCTCGTCAAGAACCTCGCGTCTCAAGTCCAATCGCTCGGCGAAGACGCGGACATGGCGAGC
GTGTGGAGAGGAGCCGAAGTCACGCGGGGCTTCAGCGACATCACGGACCAGGTCGAGGTGCGCGGCTGCGAACTC
TTGAACTCGCATCAAGATGCCGGCCCCGTAAAAGTCTTGTTCGACGGCTCCAAGCCGAGTGCTCTTGGCGACGAG
CAGCCATCTTCCAAAGACTGGGTCCAGAGCGGAGCCGACGACCAGCTGCTCTTGTTCATGCCTTTCCAGTCTTCC
ATCAAGCTTCACACTCTGCAGCTCACGTCTCTGCCGCCCAAAGACCAAACAGAAGTCTCGAGGCCCGAGGTCATC
CAGCTCTTCGTCAACCAGCCAAGAAACATGGATTTTAGCGAAGCAGACGATACCGAACCCACGCAAACGATAACG
CTGGCAGCCAACGATTGGAATTCCGACGGCACCATCAACGTCGGCCTGCGCTACGTCAAGTTCCAGAAGACGACG
TCGCTCATCATCTACGTCCAGAAGGGAGCCGACGACGCCGAGACGGTCCGGCTCGACAGGGTGAGACTCGTTGGC
GACTTCGGCCTGAAGCGAGAGATGGGCAAGCTGCAGAAGATTGGCCAAGGCCAATGA
Transcript >Ophcf2|07309
ATGTCTTCTAGCCCGTCCATTCAAATATCTTCTGCGGAGCAGTTTCAAGACCTCCTTCAGTCGTCCAAGGTCGTT
GTCGCCGGCTTTTATGGAAACGATACTTCTGGTTTCGGACGCATGACAGCTCCGCTCTACGAAACGCTGTCCCAG
TCGCTGTCCCGCCCCGATACCATCACCTTTGTCACCATCGACAAGGACAAGAATGCGCAGCTCGCCGACACATAC
GCAGTGACGGAGCTCCCCACCTTTCTACTCTTTCGAGACGCCGCCGTCATCAACAAGGCTCAAGGTCCTGACCCA
AAAGGGCTGCAAGATCTCGTCAAGAACCTCGCGTCTCAAGTCCAATCGCTCGGCGAAGACGCGGACATGGCGAGC
GTGTGGAGAGGAGCCGAAGTCACGCGGGGCTTCAGCGACATCACGGACCAGGTCGAGGTGCGCGGCTGCGAACTC
TTGAACTCGCATCAAGATGCCGGCCCCGTAAAAGTCTTGTTCGACGGCTCCAAGCCGAGTGCTCTTGGCGACGAG
CAGCCATCTTCCAAAGACTGGGTCCAGAGCGGAGCCGACGACCAGCTGCTCTTGTTCATGCCTTTCCAGTCTTCC
ATCAAGCTTCACACTCTGCAGCTCACGTCTCTGCCGCCCAAAGACCAAACAGAAGTCTCGAGGCCCGAGGTCATC
CAGCTCTTCGTCAACCAGCCAAGAAACATGGATTTTAGCGAAGCAGACGATACCGAACCCACGCAAACGATAACG
CTGGCAGCCAACGATTGGAATTCCGACGGCACCATCAACGTCGGCCTGCGCTACGTCAAGTTCCAGAAGACGACG
TCGCTCATCATCTACGTCCAGAAGGGAGCCGACGACGCCGAGACGGTCCGGCTCGACAGGGTGAGACTCGTTGGC
GACTTCGGCCTGAAGCGAGAGATGGGCAAGCTGCAGAAGATTGGCCAAGGCCAATGA
Gene >Ophcf2|07309
ATGTCTTCTAGCCCGTCCATTCAAATATCTTCTGCGGAGCAGTTTCAAGACCTCCTTCAGTCGTCCAAGGTCGTT
GTCGCCGGCTGTGAGCGAACCCCCGCGCCCTTTCCAACCCTTCCTTTGCTGGTTCGTTCCTTGCATTCACCGGCT
GACATGCTCCTGTCATAGTTTATGGAAACGATACTTCTGGTTTCGGACGCATGACAGCTCCGCTCTACGAAACGC
TGTCCCAGTCGCTGTCCCGCCCCGATACCATCACCTTTGTCACCATCGACAAGGACAAGAATGCGCAGCTCGCCG
ACACATACGCAGTGACGGAGCTCCCCACCTTTCTACTCTTTCGAGACGCCGCCGTCATCAACAAGGCTCAAGGTC
CTGACCCAAAAGGGCTGCAAGATCTCGTCAAGAACCTCGCGTCTCAAGTCCAATCGCTCGGCGAAGACGCGGACA
TGGCGAGCGTGTGGAGAGGAGCCGAAGTCACGCGGGGCTTCAGCGACATCACGGACCAGGTCGAGGTGCGCGGCT
GCGAACTCTTGAACTCGCATCAAGATGCCGGCCCCGTAAAAGTCTTGTTCGACGGCTCCAAGCCGAGTGCTCTTG
GCGACGAGCAGCCATCTTCCAAAGACTGGGTCCAGAGCGGAGCCGACGACCAGCTGCTCTTGTTCATGCCTTTCC
AGTCTTCCATCAAGCTTCACACTCTGCAGGTACGGCCGGGCCGACACGGGTTGAAAGGTTGACGGGTGCCAACAG
ACTCCGCAGCTCACGTCTCTGCCGCCCAAAGACCAAACAGAAGTCTCGAGGCCCGAGGTCATCCAGCTCTTCGTC
AACCAGCCAAGAAACATGGATTTTAGCGAAGCAGACGATACCGAACCCACGCAAACGATAACGCTGGCAGCCAAC
GATTGGAATTCCGACGGCACCATCAACGTCGGCCTGCGCTACGTCAAGTTCCAGAAGACGACGTCGCTCATCATC
TACGTCCAGAAGGGAGCCGACGACGCCGAGACGGTCCGGCTCGACAGGGTGAGACTCGTTGGCGACTTCGGCCTG
AAGCGAGAGATGGGCAAGCTGCAGAAGATTGGCCAAGGCCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail