Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07304
Gene name
Locationscaffold_09:1177366..1183287
Strand-
Gene length (bp)5921
Transcript length (bp)4482
Coding sequence length (bp)4482
Protein length (aa) 1494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 1.8E-45 1140 1288
PF00169 PH PH domain 1.6E-09 793 921

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 49.34 26.43 72.25
Alive In ants, during behavior modification 49.28 25.49 73.06
Dead In ants, recently dead 42.85 23.42 62.27

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.995577 no
Alive Dead 0.468727 no
Dead Fungus 0.526404 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07304
MKERKVEMRQRTGLATGLATGLATGLATGLATGLRLHQAVIAVVLRPPGDSAYRSLILQSGFRRQASLRRPLRAS
STQSVTCFWQTRRPLACFPRLIRSLGSFVGVVDPLRIKPRRPIAMAAPVAVVRDEAAKMLSRDSVAASSPMSSPS
KSDGQNGQAKLPDVASLIKAAGSPEAVIQHLLKEKQSQHQQNGQLWRLVDKQRAMILGLNKDLEQALKDKEKYRK
KLKDLMGNPAVLKAAGVPNGESVTDAGGRRGTTLPPVDVSVSKPRPAPTPESPSLDSDSQRDSPVEPSMAPYPIT
PPADRPQENQSAVSELLDPSRSMPKPQEHALDQFDHAAEEQAADDARKTRSEGQLKEIPYNITLPPSRSLPSDPP
KIPLPNPPTMNPPVVAVSDASPLSEPSLAKALSPTLRKQPPAPLQLKQKSGGEQQAPAEDDGSESEYDRILDVEG
PTDQGRGRRRTREEDDHERSAIAVKEAEQRSLSKKSISSGKATLSADRRSPSGPPPGPPPDPPSTADGTLRASTR
SKELAAPLLSPGLPVSPRPLSKSGSYSPGTAPPQLSPRPPRQPIPMPPNVAMSSPMAAPVTASPSKSSVKTKRVS
DQDQDSVPASAGRRGSSAERTEVYKKLMTDEYPDLLLPPNALLSIQIKVASSRMKPSRASLLSLTQLDEDPVFTL
AIISRADHGELWRVEKDIASFGKLDQRLKQCSAFTAKTPERSLFSGHAPAKLDARRVALEQYMDELLETPLDTPS
AVELCKYLSTNTLPPNADETGSAVKRQSEGNSGHTVGPDGRPIRSGYLTKKGKNFGGWKARFFVVDGPHLKYYET
PGGTHLGTIKLQNAQIGRQSQANESQPLAAAAAAAAASSSASSSTGAGGAAGDEFDNHYRHAFLILEPKKKDLTS
HVKHVLCAESDKERDLWVDVLLQWIDQREPEEADAAATTATTTTTTTTATATATTATKADRHVSVPEYPAKTRRG
GNAARSSHQPGDSGALIGVRYDSTQAGDAPHTAPSSARLDHHSSHLSMGAETMSSQAYRAISGPKDPHVISDSSA
WGNRSGLGPDEKKQRKRSFFGFGPKTRSSSDGQDSIFGGSDSGPPSAGITGGPAGPAHGPYQGPARQVFGAPLAE
AVRFSPPSDVNVPLPSVVYRCIEYLSSKNGITEEGIFRLSGSNVVIKQLRERFNTESDVNLVTDEQYYDIHAVAS
LLKLYLRELPTMILTRDLQREFLVTTEMTDRDEKVAALSELAKRLPQSNATLLKYLVSFLIRIINNAGVNKMNAR
NVGIVFSPTLNIPAPVFALFLQHYEGIFGIDPERYELPSTEAERQRRTTRALDGPTLRAGETGRPASARGGSASP
QRSTRPGNARLTPTPPPMAMTMPRGSSTPTPPPTGSRPKTYEPSWRPQHESMRLHETTTAAVPMRPAYESCYGLP
AGHELFNGPATRPTPGYERHKYGRGDDGSSGSPSPESSASRRRESNVYAASGLQHQGSKSRLREESRF*
Coding >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCTCCCGGAGAC
TCTGCTTATAGATCCTTAATCCTCCAGTCTGGTTTCCGACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCT
TCGACCCAATCGGTTACCTGTTTCTGGCAAACACGACGCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTA
GGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCAAGCCCCGAAGACCCATTGCCATGGCTGCTCCGGTGGCG
GTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCATGTCTTCTCCCAGC
AAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGGCCGGCAGTCCCGAG
GCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTATGGCGTCTGGTCGAT
AAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGGAAAAGTACCGAAAG
AAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCGAATCCGTGACCGAC
GCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGCCTGCTCCTACGCCC
GAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGCCCTATCCCATCACG
CCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCCGCTCAATGCCCAAG
CCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACGCGCGGAAGACGAGG
AGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCCCGAGCGATCCGCCC
AAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGAGCCCGCTGTCGGAG
CCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGTTGAAGCAAAAGTCG
GGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCTTGGACGTCGAAGGG
CCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCGCCATTGCCGTCAAG
GAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGGCCGATAGGCGAAGC
CCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTACGCGCGAGCACCCGC
TCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGTCCAAGAGCGGCAGC
TACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGATGCCGCCCAACGTT
GCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGACGAAGCGGGTTTCC
GACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGACCGAGGTCTATAAG
AAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTCAGATCAAGGTGGCC
TCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATCCCGTCTTCACGCTG
GCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGTTCGGCAAGCTGGAC
CAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCGGACACGCGCCCGCC
AAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCCTCGACACGCCCTCG
GCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCGGCTCGGCGGTCAAG
AGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCGGCTATCTCACGAAG
AAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCAAGTACTACGAGACG
CCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTCAAGCCAACGAGAGC
CAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGGGAGCCGGGGGCGCG
GCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGAAGGACTTGACGAGC
CATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGCTGCTGCAGTGGATC
GACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAACTACGACGGCGACG
GCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCAAGACCCGGAGGGGG
GGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTTACGACTCGACGCAG
GCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACCTGAGCATGGGCGCC
GAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCTCGGACTCGTCGGCC
TGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCGGCTTCGGCCCCAAG
ACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGTCGGCGGGCATAACC
GGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGGCACCGCTGGCCGAG
GCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCTGCATCGAATACTTG
TCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGATCAAGCAGCTCCGC
GAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCCACGCGGTGGCTTCG
CTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCGAGTTCCTGGTGACG
ACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGCCTCAGAGCAACGCG
ACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACAAGATGAATGCGCGC
AACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCTTACAGCACTACGAG
GGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGCGGCGGACGACGCGG
GCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGGGCAGCGCATCGCCA
CAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGACGATGCCTCGGGGC
TCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGCGACCACAGCACGAG
TCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTTGCTACGGCCTGCCG
GCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACAAGTACGGTCGGGGC
GACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCAACGTGTACGCGGCT
TCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG
Transcript >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCTCCCGGAGAC
TCTGCTTATAGATCCTTAATCCTCCAGTCTGGTTTCCGACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCT
TCGACCCAATCGGTTACCTGTTTCTGGCAAACACGACGCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTA
GGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCAAGCCCCGAAGACCCATTGCCATGGCTGCTCCGGTGGCG
GTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCATGTCTTCTCCCAGC
AAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGGCCGGCAGTCCCGAG
GCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTATGGCGTCTGGTCGAT
AAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGGAAAAGTACCGAAAG
AAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCGAATCCGTGACCGAC
GCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGCCTGCTCCTACGCCC
GAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGCCCTATCCCATCACG
CCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCCGCTCAATGCCCAAG
CCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACGCGCGGAAGACGAGG
AGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCCCGAGCGATCCGCCC
AAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGAGCCCGCTGTCGGAG
CCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGTTGAAGCAAAAGTCG
GGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCTTGGACGTCGAAGGG
CCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCGCCATTGCCGTCAAG
GAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGGCCGATAGGCGAAGC
CCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTACGCGCGAGCACCCGC
TCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGTCCAAGAGCGGCAGC
TACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGATGCCGCCCAACGTT
GCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGACGAAGCGGGTTTCC
GACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGACCGAGGTCTATAAG
AAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTCAGATCAAGGTGGCC
TCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATCCCGTCTTCACGCTG
GCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGTTCGGCAAGCTGGAC
CAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCGGACACGCGCCCGCC
AAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCCTCGACACGCCCTCG
GCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCGGCTCGGCGGTCAAG
AGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCGGCTATCTCACGAAG
AAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCAAGTACTACGAGACG
CCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTCAAGCCAACGAGAGC
CAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGGGAGCCGGGGGCGCG
GCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGAAGGACTTGACGAGC
CATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGCTGCTGCAGTGGATC
GACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAACTACGACGGCGACG
GCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCAAGACCCGGAGGGGG
GGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTTACGACTCGACGCAG
GCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACCTGAGCATGGGCGCC
GAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCTCGGACTCGTCGGCC
TGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCGGCTTCGGCCCCAAG
ACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGTCGGCGGGCATAACC
GGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGGCACCGCTGGCCGAG
GCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCTGCATCGAATACTTG
TCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGATCAAGCAGCTCCGC
GAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCCACGCGGTGGCTTCG
CTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCGAGTTCCTGGTGACG
ACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGCCTCAGAGCAACGCG
ACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACAAGATGAATGCGCGC
AACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCTTACAGCACTACGAG
GGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGCGGCGGACGACGCGG
GCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGGGCAGCGCATCGCCA
CAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGACGATGCCTCGGGGC
TCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGCGACCACAGCACGAG
TCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTTGCTACGGCCTGCCG
GCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACAAGTACGGTCGGGGC
GACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCAACGTGTACGCGGCT
TCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG
Gene >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTGTTGGTTCGTGCTTCCTTTCTCGAGGGGAACGGGAGGGAAAAGGTCCG
ATGCATGGATTGGATGCTCTGCGACACGAGATGAGCGAAGGCTGCGGCACAGCGGCGCAGGGATCCATTCATCCA
TGACTCTTTTTTTGGGCCGTCTCATGCCGGGCGAGGCAAGACGCCACGACGGCAATTCCAGTGGTGTGTGTCCGG
TCGGGAGTCCAGATGGTAGGTAGGTATGTACCTACATAGGTACCTAATGGGGGAATATGGAGGGTCGAGAGGGTC
CAAGCCGCCGTCTCGAGAGCCTGGCTCAGGTATCGCAGAGCCGCTACGGCCTCTGGTCGACGACGCTATTGGTAC
CGCCAGCACGGGCTTCCCCTGCTAGTATGTACGCGTCTGGCCGCTAATCCCCTATGTGCCTTCCTGGAAAGTACC
TACCTATGTATGTAGTGTGTAGGTACCTAGATAGGTAGGTGCCTAGGTAGGTAGGTACATATCTGCTAATACTAA
AGGGCCATCGACTTGACAGCGGCCGCCTCGTCGCGCTTTTACCACCGTCAGGCTGCCCGCCTCCCGCCCAGCCCG
CAGCAGCAGAGCCCCCTCCCCCCAATCCATCCCCTTCCGGGCACCCCTAGGTTCCCCTCAGGTCATCCACTCCAG
CGGCCCCGGTAGCGGCACGCCCACTGGAAGCCCACTGCAGCAGTGGACACCGAACCCACCCGCACCTCCTCCATC
AACCCATTGAGCCCATGGATTGATCCATCAACCATCCGTCCTCGTCCTCGTCCTTCATCCCGCCTCGTTCGTCCA
TCGTAGCCCTCGTCTCGGGCTCCGTGGCGCTTCCGCTCGTCTCTTGATCCTTGCGGACTCGACATCTTCTTTTCC
TCCTCCTCCTGGTCCTCCTCCTCCTTCCCCTCCTCCTTCCTTCTCTCTCGCCTCCTCCTTTCTCCTCCCTTCCGG
CCGACACCCCTTCGTCCGCCTCGTCCTGGATGACAGCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCT
CCCGGAGACTCTGCTTATAGGTGTGTGGCACAAGATTGGCGTCATTCCCATCAGCCTCGTATGCGCCTGCTTGCC
GATTCGCTCGTTGGCTCTCTGCCGGCCGTCATCGACGTCGACGCGCCGACTCTCTGCTTTGCGCTGCTCTCTCAG
CCCGCTGTTTCCCTTGTCCCTTTTGATTCGGACTCGAGTCCGTCTGCGAATGCCGTCTTGATCCTCGTCGATGCC
GCCAATTCGTCTTGTTCGCCTTGGCTGACCCCTTCTCTCGCCCTTCTAGATCCTTAATCCTCCAGTCTGGTTTCC
GACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCTTCGACCCAATCGGTTACCTGTTTCTGGCAAACACGAC
GCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTAGGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCA
AGCCCCGAAGGTGCGTCGACGGTGTGCTCAAAACAGGCAGTCAATAACCGGCTAGAACAAGACTTGCTGATGTCG
CCCTCAGACCCATTGTCGGTTCCGGATGACTCTCGACACGATTAGACAGTCCACAATCTGAATCATCTCTGCTTC
AAAACCACCCGATAGAATAGAACCGCCTATAGAGCCGCTTCGGGTTGGGCCCCTAATCGGAACCCAAGGCCATGG
CTGCTCCGGTGGCGGTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCA
TGTCTTCTCCCAGCAAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGG
CCGGCAGTCCCGAGGCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTAT
GGCGTCTGGTCGATAAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGG
AAAAGTACCGAAAGAAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCG
AATCCGTGACCGACGCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGC
CTGCTCCTACGCCCGAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGC
CCTATCCCATCACGCCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCC
GCTCAATGCCCAAGCCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACG
CGCGGAAGACGAGGAGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCC
CGAGCGATCCGCCCAAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGA
GCCCGCTGTCGGAGCCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGT
TGAAGCAAAAGTCGGGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCT
TGGACGTCGAAGGGCCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCG
CCATTGCCGTCAAGGAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGG
CCGATAGGCGAAGCCCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTAC
GCGCGAGCACCCGCTCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGT
CCAAGAGCGGCAGCTACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGA
TGCCGCCCAACGTTGCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGA
CGAAGCGGGTTTCCGACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGA
CCGAGGTCTATAAGAAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTC
AGATCAAGGTGGCCTCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATC
CCGTCTTCACGCTGGCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGT
TCGGCAAGCTGGACCAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCG
GACACGCGCCCGCCAAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCC
TCGACACGCCCTCGGCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCG
GCTCGGCGGTCAAGAGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCG
GCTATCTCACGAAGAAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCA
AGTACTACGAGACGCCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTC
AAGCCAACGAGAGCCAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGG
GAGCCGGGGGCGCGGCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGA
AGGACTTGACGAGCCATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGC
TGCTGCAGTGGATCGACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAA
CTACGACGGCGACGGCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCA
AGACCCGGAGGGGGGGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTT
ACGACTCGACGCAGGCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACC
TGAGCATGGGCGCCGAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCT
CGGACTCGTCGGCCTGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCG
GCTTCGGCCCCAAGACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGT
CGGCGGGCATAACCGGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGG
CACCGCTGGCCGAGGCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCT
GCATCGAATACTTGTCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGA
TCAAGCAGCTCCGCGAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCC
ACGCGGTGGCTTCGCTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCG
AGTTCCTGGTGACGACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGC
CTCAGAGCAACGCGACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACA
AGATGAATGCGCGCAACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCT
TACAGCACTACGAGGGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGC
GGCGGACGACGCGGGCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGG
GCAGCGCATCGCCACAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGA
CGATGCCTCGGGGCTCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGC
GACCACAGCACGAGTCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTT
GCTACGGCCTGCCGGCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACA
AGTACGGTCGGGGCGACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCA
ACGTGTACGCGGCTTCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail