Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07304
Gene name
Locationscaffold_09:1177366..1183287
Strand-
Gene length (bp)5921
Transcript length (bp)4482
Coding sequence length (bp)4482
Protein length (aa) 1494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 1.8E-45 1140 1288
PF00169 PH PH domain 1.6E-09 793 921

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07304
MKERKVEMRQRTGLATGLATGLATGLATGLATGLRLHQAVIAVVLRPPGDSAYRSLILQSGFRRQASLRRPLRAS
STQSVTCFWQTRRPLACFPRLIRSLGSFVGVVDPLRIKPRRPIAMAAPVAVVRDEAAKMLSRDSVAASSPMSSPS
KSDGQNGQAKLPDVASLIKAAGSPEAVIQHLLKEKQSQHQQNGQLWRLVDKQRAMILGLNKDLEQALKDKEKYRK
KLKDLMGNPAVLKAAGVPNGESVTDAGGRRGTTLPPVDVSVSKPRPAPTPESPSLDSDSQRDSPVEPSMAPYPIT
PPADRPQENQSAVSELLDPSRSMPKPQEHALDQFDHAAEEQAADDARKTRSEGQLKEIPYNITLPPSRSLPSDPP
KIPLPNPPTMNPPVVAVSDASPLSEPSLAKALSPTLRKQPPAPLQLKQKSGGEQQAPAEDDGSESEYDRILDVEG
PTDQGRGRRRTREEDDHERSAIAVKEAEQRSLSKKSISSGKATLSADRRSPSGPPPGPPPDPPSTADGTLRASTR
SKELAAPLLSPGLPVSPRPLSKSGSYSPGTAPPQLSPRPPRQPIPMPPNVAMSSPMAAPVTASPSKSSVKTKRVS
DQDQDSVPASAGRRGSSAERTEVYKKLMTDEYPDLLLPPNALLSIQIKVASSRMKPSRASLLSLTQLDEDPVFTL
AIISRADHGELWRVEKDIASFGKLDQRLKQCSAFTAKTPERSLFSGHAPAKLDARRVALEQYMDELLETPLDTPS
AVELCKYLSTNTLPPNADETGSAVKRQSEGNSGHTVGPDGRPIRSGYLTKKGKNFGGWKARFFVVDGPHLKYYET
PGGTHLGTIKLQNAQIGRQSQANESQPLAAAAAAAAASSSASSSTGAGGAAGDEFDNHYRHAFLILEPKKKDLTS
HVKHVLCAESDKERDLWVDVLLQWIDQREPEEADAAATTATTTTTTTTATATATTATKADRHVSVPEYPAKTRRG
GNAARSSHQPGDSGALIGVRYDSTQAGDAPHTAPSSARLDHHSSHLSMGAETMSSQAYRAISGPKDPHVISDSSA
WGNRSGLGPDEKKQRKRSFFGFGPKTRSSSDGQDSIFGGSDSGPPSAGITGGPAGPAHGPYQGPARQVFGAPLAE
AVRFSPPSDVNVPLPSVVYRCIEYLSSKNGITEEGIFRLSGSNVVIKQLRERFNTESDVNLVTDEQYYDIHAVAS
LLKLYLRELPTMILTRDLQREFLVTTEMTDRDEKVAALSELAKRLPQSNATLLKYLVSFLIRIINNAGVNKMNAR
NVGIVFSPTLNIPAPVFALFLQHYEGIFGIDPERYELPSTEAERQRRTTRALDGPTLRAGETGRPASARGGSASP
QRSTRPGNARLTPTPPPMAMTMPRGSSTPTPPPTGSRPKTYEPSWRPQHESMRLHETTTAAVPMRPAYESCYGLP
AGHELFNGPATRPTPGYERHKYGRGDDGSSGSPSPESSASRRRESNVYAASGLQHQGSKSRLREESRF*
Coding >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCTCCCGGAGAC
TCTGCTTATAGATCCTTAATCCTCCAGTCTGGTTTCCGACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCT
TCGACCCAATCGGTTACCTGTTTCTGGCAAACACGACGCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTA
GGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCAAGCCCCGAAGACCCATTGCCATGGCTGCTCCGGTGGCG
GTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCATGTCTTCTCCCAGC
AAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGGCCGGCAGTCCCGAG
GCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTATGGCGTCTGGTCGAT
AAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGGAAAAGTACCGAAAG
AAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCGAATCCGTGACCGAC
GCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGCCTGCTCCTACGCCC
GAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGCCCTATCCCATCACG
CCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCCGCTCAATGCCCAAG
CCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACGCGCGGAAGACGAGG
AGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCCCGAGCGATCCGCCC
AAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGAGCCCGCTGTCGGAG
CCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGTTGAAGCAAAAGTCG
GGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCTTGGACGTCGAAGGG
CCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCGCCATTGCCGTCAAG
GAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGGCCGATAGGCGAAGC
CCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTACGCGCGAGCACCCGC
TCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGTCCAAGAGCGGCAGC
TACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGATGCCGCCCAACGTT
GCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGACGAAGCGGGTTTCC
GACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGACCGAGGTCTATAAG
AAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTCAGATCAAGGTGGCC
TCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATCCCGTCTTCACGCTG
GCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGTTCGGCAAGCTGGAC
CAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCGGACACGCGCCCGCC
AAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCCTCGACACGCCCTCG
GCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCGGCTCGGCGGTCAAG
AGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCGGCTATCTCACGAAG
AAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCAAGTACTACGAGACG
CCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTCAAGCCAACGAGAGC
CAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGGGAGCCGGGGGCGCG
GCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGAAGGACTTGACGAGC
CATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGCTGCTGCAGTGGATC
GACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAACTACGACGGCGACG
GCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCAAGACCCGGAGGGGG
GGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTTACGACTCGACGCAG
GCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACCTGAGCATGGGCGCC
GAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCTCGGACTCGTCGGCC
TGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCGGCTTCGGCCCCAAG
ACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGTCGGCGGGCATAACC
GGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGGCACCGCTGGCCGAG
GCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCTGCATCGAATACTTG
TCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGATCAAGCAGCTCCGC
GAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCCACGCGGTGGCTTCG
CTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCGAGTTCCTGGTGACG
ACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGCCTCAGAGCAACGCG
ACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACAAGATGAATGCGCGC
AACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCTTACAGCACTACGAG
GGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGCGGCGGACGACGCGG
GCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGGGCAGCGCATCGCCA
CAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGACGATGCCTCGGGGC
TCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGCGACCACAGCACGAG
TCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTTGCTACGGCCTGCCG
GCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACAAGTACGGTCGGGGC
GACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCAACGTGTACGCGGCT
TCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG
Transcript >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCTCCCGGAGAC
TCTGCTTATAGATCCTTAATCCTCCAGTCTGGTTTCCGACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCT
TCGACCCAATCGGTTACCTGTTTCTGGCAAACACGACGCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTA
GGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCAAGCCCCGAAGACCCATTGCCATGGCTGCTCCGGTGGCG
GTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCATGTCTTCTCCCAGC
AAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGGCCGGCAGTCCCGAG
GCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTATGGCGTCTGGTCGAT
AAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGGAAAAGTACCGAAAG
AAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCGAATCCGTGACCGAC
GCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGCCTGCTCCTACGCCC
GAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGCCCTATCCCATCACG
CCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCCGCTCAATGCCCAAG
CCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACGCGCGGAAGACGAGG
AGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCCCGAGCGATCCGCCC
AAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGAGCCCGCTGTCGGAG
CCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGTTGAAGCAAAAGTCG
GGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCTTGGACGTCGAAGGG
CCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCGCCATTGCCGTCAAG
GAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGGCCGATAGGCGAAGC
CCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTACGCGCGAGCACCCGC
TCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGTCCAAGAGCGGCAGC
TACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGATGCCGCCCAACGTT
GCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGACGAAGCGGGTTTCC
GACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGACCGAGGTCTATAAG
AAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTCAGATCAAGGTGGCC
TCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATCCCGTCTTCACGCTG
GCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGTTCGGCAAGCTGGAC
CAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCGGACACGCGCCCGCC
AAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCCTCGACACGCCCTCG
GCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCGGCTCGGCGGTCAAG
AGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCGGCTATCTCACGAAG
AAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCAAGTACTACGAGACG
CCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTCAAGCCAACGAGAGC
CAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGGGAGCCGGGGGCGCG
GCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGAAGGACTTGACGAGC
CATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGCTGCTGCAGTGGATC
GACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAACTACGACGGCGACG
GCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCAAGACCCGGAGGGGG
GGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTTACGACTCGACGCAG
GCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACCTGAGCATGGGCGCC
GAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCTCGGACTCGTCGGCC
TGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCGGCTTCGGCCCCAAG
ACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGTCGGCGGGCATAACC
GGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGGCACCGCTGGCCGAG
GCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCTGCATCGAATACTTG
TCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGATCAAGCAGCTCCGC
GAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCCACGCGGTGGCTTCG
CTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCGAGTTCCTGGTGACG
ACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGCCTCAGAGCAACGCG
ACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACAAGATGAATGCGCGC
AACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCTTACAGCACTACGAG
GGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGCGGCGGACGACGCGG
GCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGGGCAGCGCATCGCCA
CAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGACGATGCCTCGGGGC
TCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGCGACCACAGCACGAG
TCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTTGCTACGGCCTGCCG
GCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACAAGTACGGTCGGGGC
GACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCAACGTGTACGCGGCT
TCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG
Gene >Ophcf2|07304
ATGAAGGAGAGAAAGGTCGAGATGAGACAACGAACGGGTCTTGCAACGGGTCTTGCAACGGGTCTTGCAACGGGT
CTTGCAACGGGTCTTGCAACGGGTCTTGTTGGTTCGTGCTTCCTTTCTCGAGGGGAACGGGAGGGAAAAGGTCCG
ATGCATGGATTGGATGCTCTGCGACACGAGATGAGCGAAGGCTGCGGCACAGCGGCGCAGGGATCCATTCATCCA
TGACTCTTTTTTTGGGCCGTCTCATGCCGGGCGAGGCAAGACGCCACGACGGCAATTCCAGTGGTGTGTGTCCGG
TCGGGAGTCCAGATGGTAGGTAGGTATGTACCTACATAGGTACCTAATGGGGGAATATGGAGGGTCGAGAGGGTC
CAAGCCGCCGTCTCGAGAGCCTGGCTCAGGTATCGCAGAGCCGCTACGGCCTCTGGTCGACGACGCTATTGGTAC
CGCCAGCACGGGCTTCCCCTGCTAGTATGTACGCGTCTGGCCGCTAATCCCCTATGTGCCTTCCTGGAAAGTACC
TACCTATGTATGTAGTGTGTAGGTACCTAGATAGGTAGGTGCCTAGGTAGGTAGGTACATATCTGCTAATACTAA
AGGGCCATCGACTTGACAGCGGCCGCCTCGTCGCGCTTTTACCACCGTCAGGCTGCCCGCCTCCCGCCCAGCCCG
CAGCAGCAGAGCCCCCTCCCCCCAATCCATCCCCTTCCGGGCACCCCTAGGTTCCCCTCAGGTCATCCACTCCAG
CGGCCCCGGTAGCGGCACGCCCACTGGAAGCCCACTGCAGCAGTGGACACCGAACCCACCCGCACCTCCTCCATC
AACCCATTGAGCCCATGGATTGATCCATCAACCATCCGTCCTCGTCCTCGTCCTTCATCCCGCCTCGTTCGTCCA
TCGTAGCCCTCGTCTCGGGCTCCGTGGCGCTTCCGCTCGTCTCTTGATCCTTGCGGACTCGACATCTTCTTTTCC
TCCTCCTCCTGGTCCTCCTCCTCCTTCCCCTCCTCCTTCCTTCTCTCTCGCCTCCTCCTTTCTCCTCCCTTCCGG
CCGACACCCCTTCGTCCGCCTCGTCCTGGATGACAGCGCCTTCATCAGGCCGTCATCGCTGTCGTCCTGCGCCCT
CCCGGAGACTCTGCTTATAGGTGTGTGGCACAAGATTGGCGTCATTCCCATCAGCCTCGTATGCGCCTGCTTGCC
GATTCGCTCGTTGGCTCTCTGCCGGCCGTCATCGACGTCGACGCGCCGACTCTCTGCTTTGCGCTGCTCTCTCAG
CCCGCTGTTTCCCTTGTCCCTTTTGATTCGGACTCGAGTCCGTCTGCGAATGCCGTCTTGATCCTCGTCGATGCC
GCCAATTCGTCTTGTTCGCCTTGGCTGACCCCTTCTCTCGCCCTTCTAGATCCTTAATCCTCCAGTCTGGTTTCC
GACGACAAGCATCGCTGCGACGCCCTCTTCGGGCCTCTTCGACCCAATCGGTTACCTGTTTCTGGCAAACACGAC
GCCCTCTGGCCTGCTTCCCCCGTTTAATCCGCTCTCTAGGCTCATTCGTCGGCGTCGTCGACCCGCTGAGGATCA
AGCCCCGAAGGTGCGTCGACGGTGTGCTCAAAACAGGCAGTCAATAACCGGCTAGAACAAGACTTGCTGATGTCG
CCCTCAGACCCATTGTCGGTTCCGGATGACTCTCGACACGATTAGACAGTCCACAATCTGAATCATCTCTGCTTC
AAAACCACCCGATAGAATAGAACCGCCTATAGAGCCGCTTCGGGTTGGGCCCCTAATCGGAACCCAAGGCCATGG
CTGCTCCGGTGGCGGTCGTCCGGGACGAAGCGGCAAAGATGCTCTCCCGGGACTCAGTCGCCGCGTCATCCCCCA
TGTCTTCTCCCAGCAAGTCCGATGGTCAGAACGGCCAGGCAAAGCTCCCGGACGTGGCCAGCCTCATCAAGGCGG
CCGGCAGTCCCGAGGCTGTCATCCAACACCTTCTCAAGGAGAAGCAGTCGCAACACCAGCAAAACGGTCAGCTAT
GGCGTCTGGTCGATAAGCAGAGGGCCATGATCCTCGGCCTGAACAAGGACCTGGAGCAGGCGCTCAAGGACAAGG
AAAAGTACCGAAAGAAGCTCAAGGACCTCATGGGGAATCCGGCCGTCCTCAAGGCTGCGGGTGTCCCCAACGGCG
AATCCGTGACCGACGCGGGAGGACGACGCGGGACGACGCTTCCACCGGTTGATGTCTCCGTTTCCAAGCCCAGGC
CTGCTCCTACGCCCGAGTCTCCGAGCCTCGATTCCGACAGCCAAAGAGACTCGCCCGTCGAACCGTCGATGGCGC
CCTATCCCATCACGCCGCCCGCCGATCGGCCGCAAGAGAACCAGTCCGCCGTGAGCGAGCTGCTGGACCCCAGCC
GCTCAATGCCCAAGCCCCAGGAGCACGCCCTCGACCAGTTCGATCACGCGGCCGAGGAACAGGCCGCCGACGACG
CGCGGAAGACGAGGAGTGAAGGGCAGCTCAAGGAAATCCCCTACAACATCACGCTGCCTCCGTCTCGCTCTCTCC
CGAGCGATCCGCCCAAGATACCCCTGCCGAACCCTCCGACCATGAACCCGCCGGTTGTCGCCGTGTCCGATGCGA
GCCCGCTGTCGGAGCCTAGTCTGGCCAAGGCGCTGTCGCCGACGCTCCGGAAACAACCTCCGGCCCCGCTGCAGT
TGAAGCAAAAGTCGGGCGGTGAGCAGCAGGCGCCGGCCGAAGACGACGGAAGCGAGTCCGAGTACGACCGCATCT
TGGACGTCGAAGGGCCCACCGATCAAGGAAGAGGCCGACGCAGGACGCGTGAAGAGGACGATCACGAGCGGAGCG
CCATTGCCGTCAAGGAGGCCGAGCAACGGAGCCTCTCCAAGAAGAGCATATCGAGCGGTAAAGCGACGCTCTCGG
CCGATAGGCGAAGCCCATCTGGCCCGCCTCCCGGACCGCCGCCCGACCCGCCGTCGACCGCGGACGGGACCCTAC
GCGCGAGCACCCGCTCGAAGGAGCTGGCCGCTCCCCTCCTCAGCCCCGGGCTCCCCGTCAGCCCCCGGCCTCTGT
CCAAGAGCGGCAGCTACTCGCCCGGCACAGCTCCGCCTCAGCTCTCGCCCCGGCCCCCGCGCCAGCCGATCCCGA
TGCCGCCCAACGTTGCCATGTCTTCGCCCATGGCCGCCCCCGTCACGGCGTCTCCCTCGAAATCTTCGGTCAAGA
CGAAGCGGGTTTCCGACCAGGATCAGGACTCGGTGCCCGCCTCCGCCGGACGTCGCGGTAGCTCTGCGGAGCGGA
CCGAGGTCTATAAGAAGCTCATGACGGACGAATACCCCGACCTGCTACTGCCGCCCAACGCCTTGTTGTCGATTC
AGATCAAGGTGGCCTCTTCGCGCATGAAGCCTTCGAGGGCCAGTCTACTGTCCCTGACGCAATTAGACGAAGATC
CCGTCTTCACGCTGGCCATCATCTCGCGCGCCGACCACGGCGAGCTGTGGCGGGTTGAAAAGGACATTGCCTCGT
TCGGCAAGCTGGACCAGCGGCTGAAGCAGTGCTCCGCCTTCACGGCCAAGACGCCCGAGCGGTCCCTCTTCAGCG
GACACGCGCCCGCCAAGCTGGACGCCCGCCGCGTGGCCCTGGAGCAGTACATGGACGAGCTCCTCGAAACGCCCC
TCGACACGCCCTCGGCCGTGGAGCTCTGCAAGTATCTGTCGACTAACACGCTGCCGCCTAACGCCGACGAGACCG
GCTCGGCGGTCAAGAGGCAGTCGGAAGGGAATAGCGGACATACTGTTGGCCCCGACGGGCGACCCATCCGCAGCG
GCTATCTCACGAAGAAGGGCAAGAATTTTGGAGGGTGGAAGGCGAGGTTCTTCGTCGTCGACGGGCCTCACCTCA
AGTACTACGAGACGCCGGGCGGCACACACCTGGGCACCATTAAGCTGCAGAACGCACAGATCGGACGGCAATCTC
AAGCCAACGAGAGCCAGCCCTTGGCGGCAGCGGCGGCGGCGGCGGCAGCATCATCATCTGCGTCTTCATCAACGG
GAGCCGGGGGCGCGGCGGGCGACGAGTTCGACAACCACTACCGCCACGCGTTCCTCATCCTGGAGCCCAAGAAGA
AGGACTTGACGAGCCATGTCAAACACGTGCTGTGCGCGGAGAGCGACAAGGAGCGAGACCTCTGGGTGGACGTGC
TGCTGCAGTGGATCGACCAGCGGGAACCCGAAGAGGCCGACGCAGCCGCGACGACGGCGACGACGACGACAACAA
CTACGACGGCGACGGCGACGGCGACGACTGCGACCAAGGCGGACCGGCACGTGTCGGTGCCCGAGTATCCGGCCA
AGACCCGGAGGGGGGGCAACGCGGCCCGGTCATCGCATCAGCCCGGCGACTCGGGCGCGCTGATCGGTGTCCGTT
ACGACTCGACGCAGGCCGGTGACGCGCCTCACACGGCTCCCTCGTCGGCGAGGCTGGATCACCACTCTTCTCACC
TGAGCATGGGCGCCGAGACGATGAGCTCGCAGGCGTACAGGGCCATCTCCGGACCCAAGGACCCGCACGTCATCT
CGGACTCGTCGGCCTGGGGCAACCGGTCCGGCCTCGGCCCCGACGAGAAGAAGCAGCGCAAGCGGAGCTTCTTCG
GCTTCGGCCCCAAGACGCGCTCATCCTCGGACGGGCAAGACTCCATCTTCGGCGGCAGCGACTCCGGGCCCCCGT
CGGCGGGCATAACCGGAGGTCCGGCCGGACCGGCTCACGGGCCATATCAGGGGCCGGCGCGGCAGGTGTTCGGGG
CACCGCTGGCCGAGGCAGTCCGGTTCAGCCCTCCGTCTGACGTCAACGTTCCGTTGCCTTCGGTGGTCTACCGCT
GCATCGAATACTTGTCGAGCAAGAACGGCATCACGGAGGAGGGCATCTTCCGACTGAGCGGCTCCAACGTGGTGA
TCAAGCAGCTCCGCGAGCGCTTCAACACGGAGAGCGACGTCAACCTGGTGACGGATGAGCAGTACTACGACATCC
ACGCGGTGGCTTCGCTGCTGAAGCTATACCTACGAGAGCTGCCGACGATGATCTTGACGAGGGATCTCCAGCGCG
AGTTCCTGGTGACGACGGAGATGACGGACCGCGACGAGAAGGTGGCGGCGCTGAGCGAGCTGGCCAAGAGGTTGC
CTCAGAGCAACGCGACGCTGCTCAAGTACCTCGTCTCGTTCCTCATCCGCATCATCAACAACGCGGGCGTCAACA
AGATGAATGCGCGCAACGTGGGCATCGTCTTCTCGCCGACGCTCAACATCCCGGCGCCCGTATTCGCCCTCTTCT
TACAGCACTACGAGGGCATCTTCGGCATCGACCCGGAGCGGTACGAGCTGCCGTCGACCGAGGCGGAGCGGCAGC
GGCGGACGACGCGGGCGCTGGACGGACCGACGCTCCGGGCTGGAGAGACGGGACGGCCGGCATCGGCGCGGGGGG
GCAGCGCATCGCCACAGCGGTCGACGAGGCCCGGCAACGCGCGTCTAACGCCGACACCGCCGCCCATGGCCATGA
CGATGCCTCGGGGCTCGTCGACGCCGACACCGCCTCCGACGGGGTCGCGACCCAAGACATACGAGCCTTCGTGGC
GACCACAGCACGAGTCGATGCGGCTGCACGAGACGACGACGGCGGCGGTGCCGATGCGGCCGGCGTACGAAAGTT
GCTACGGCCTGCCGGCGGGACACGAGCTCTTCAACGGGCCGGCTACGCGTCCGACGCCCGGGTACGAGAGACACA
AGTACGGTCGGGGCGACGACGGCAGCAGCGGATCGCCATCTCCGGAGTCGTCGGCGTCGAGGCGAAGGGAGAGCA
ACGTGTACGCGGCTTCGGGTCTTCAGCACCAGGGGTCCAAGAGCCGACTGCGCGAGGAGTCGCGGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail