Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07299
Gene name
Locationscaffold_09:1165387..1166864
Strand-
Gene length (bp)1477
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.7E-32 142 381

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6116 0.3357 0.0321 0.1602 0.1113 0.0107 0.1318 0.2652 0.2758 0.0768

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4586
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4635
Ophiocordyceps australis map64 (Brazil) OphauB2|4902
Ophiocordyceps camponoti-floridani Ophcf2|07299 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4467
Ophiocordyceps kimflemingae Ophio5|7607
Ophiocordyceps subramaniannii Hirsu2|9628

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07299
MPSPEPSSPSRSSAAAAADLHPPPSPRTHRALRRLQSAHNLGSPSPSLIAQQRRGFCGSASSSEAGRSPQRGRAY
SDATCSLDGNAARRSVAKRPVFSHGHLSLQHIIREGPNDGDFIGALESARWKVVDEGIKSAEDGMSTLRIYVWLV
LLDAPIMPTDEYLGLIHRGPSPAYSKIRNDTFRTLTTDPLFRRRVSEASLIRLLNAIAWKLHDAKEDQRQSRPSS
RQSSHPRESLVGSVSGHSQAKSSVGPEPGTYVQGMNVLAAPFLYAARSEAEAFVAFHSLLTRECPAYIRGAMDGV
HRGLALVDKVLAIVDPKLSMYLTAKGLSAEIYAFPSVLTLCACTPPLPEVLRLWDFLFAYGPHLNIVCIVAQLTI
MRSQILQSPSPNKVLRSFPQLHAHLVKSVTIGIIKKIPDDVYAEIVSHAL*
Coding >Ophcf2|07299
ATGCCGAGCCCCGAACCCTCCTCCCCATCTCGCTCCTCCGCCGCCGCCGCCGCCGATCTTCACCCACCGCCCTCG
CCTCGGACGCATCGCGCCCTGCGCCGCCTGCAGTCAGCTCATAACCTCGGCTCGCCTTCGCCTTCGCTCATCGCT
CAGCAGCGTAGGGGCTTTTGCGGGAGCGCCTCGTCCAGCGAAGCCGGTCGTTCGCCTCAGAGGGGCCGCGCCTAT
AGCGATGCGACGTGCTCCCTGGACGGTAATGCCGCCAGGCGGTCTGTCGCCAAGAGGCCGGTTTTCTCGCATGGT
CATCTGTCGCTGCAGCATATCATTCGCGAGGGGCCCAATGATGGGGATTTCATCGGCGCGCTTGAGAGTGCGAGG
TGGAAGGTTGTAGATGAGGGCATCAAGAGCGCCGAGGATGGAATGTCGACGCTGAGGATATACGTCTGGCTCGTC
CTCCTTGACGCGCCCATCATGCCTACCGACGAATACCTGGGTCTCATCCATCGCGGTCCTTCGCCCGCCTACTCC
AAGATCCGCAACGATACCTTTCGTACCCTCACCACCGATCCTCTGTTTCGCCGGCGCGTCAGCGAGGCCAGTCTG
ATCCGTCTCCTCAACGCCATCGCCTGGAAGCTACATGACGCCAAAGAGGATCAACGACAGAGCCGACCGAGCAGT
CGCCAATCCTCCCATCCTCGCGAAAGCCTCGTCGGCAGCGTCTCTGGCCACTCACAAGCGAAGTCCAGCGTCGGC
CCGGAACCAGGCACTTACGTCCAGGGCATGAACGTCCTCGCAGCGCCTTTTCTCTACGCCGCCCGCAGCGAGGCC
GAAGCCTTCGTCGCCTTCCACTCGCTCCTCACGCGCGAGTGCCCAGCCTACATCCGAGGCGCCATGGACGGCGTC
CACCGCGGCCTCGCCCTCGTCGACAAGGTCCTTGCCATTGTCGACCCCAAGCTCAGCATGTACCTGACGGCCAAG
GGACTGTCAGCCGAGATCTACGCTTTCCCCTCCGTCTTGACTCTCTGCGCTTGCACGCCGCCTCTGCCCGAGGTG
TTGCGTCTCTGGGACTTTCTCTTCGCTTACGGGCCGCATCTTAACATCGTCTGCATTGTCGCCCAGCTGACTATC
ATGAGGTCGCAGATCCTCCAGTCTCCCAGCCCCAACAAGGTGCTTCGATCGTTTCCGCAGTTGCACGCCCATCTC
GTCAAAAGCGTCACCATTGGCATCATTAAGAAGATCCCCGACGACGTCTATGCAGAGATTGTCTCCCACGCCCTC
TAG
Transcript >Ophcf2|07299
ATGCCGAGCCCCGAACCCTCCTCCCCATCTCGCTCCTCCGCCGCCGCCGCCGCCGATCTTCACCCACCGCCCTCG
CCTCGGACGCATCGCGCCCTGCGCCGCCTGCAGTCAGCTCATAACCTCGGCTCGCCTTCGCCTTCGCTCATCGCT
CAGCAGCGTAGGGGCTTTTGCGGGAGCGCCTCGTCCAGCGAAGCCGGTCGTTCGCCTCAGAGGGGCCGCGCCTAT
AGCGATGCGACGTGCTCCCTGGACGGTAATGCCGCCAGGCGGTCTGTCGCCAAGAGGCCGGTTTTCTCGCATGGT
CATCTGTCGCTGCAGCATATCATTCGCGAGGGGCCCAATGATGGGGATTTCATCGGCGCGCTTGAGAGTGCGAGG
TGGAAGGTTGTAGATGAGGGCATCAAGAGCGCCGAGGATGGAATGTCGACGCTGAGGATATACGTCTGGCTCGTC
CTCCTTGACGCGCCCATCATGCCTACCGACGAATACCTGGGTCTCATCCATCGCGGTCCTTCGCCCGCCTACTCC
AAGATCCGCAACGATACCTTTCGTACCCTCACCACCGATCCTCTGTTTCGCCGGCGCGTCAGCGAGGCCAGTCTG
ATCCGTCTCCTCAACGCCATCGCCTGGAAGCTACATGACGCCAAAGAGGATCAACGACAGAGCCGACCGAGCAGT
CGCCAATCCTCCCATCCTCGCGAAAGCCTCGTCGGCAGCGTCTCTGGCCACTCACAAGCGAAGTCCAGCGTCGGC
CCGGAACCAGGCACTTACGTCCAGGGCATGAACGTCCTCGCAGCGCCTTTTCTCTACGCCGCCCGCAGCGAGGCC
GAAGCCTTCGTCGCCTTCCACTCGCTCCTCACGCGCGAGTGCCCAGCCTACATCCGAGGCGCCATGGACGGCGTC
CACCGCGGCCTCGCCCTCGTCGACAAGGTCCTTGCCATTGTCGACCCCAAGCTCAGCATGTACCTGACGGCCAAG
GGACTGTCAGCCGAGATCTACGCTTTCCCCTCCGTCTTGACTCTCTGCGCTTGCACGCCGCCTCTGCCCGAGGTG
TTGCGTCTCTGGGACTTTCTCTTCGCTTACGGGCCGCATCTTAACATCGTCTGCATTGTCGCCCAGCTGACTATC
ATGAGGTCGCAGATCCTCCAGTCTCCCAGCCCCAACAAGGTGCTTCGATCGTTTCCGCAGTTGCACGCCCATCTC
GTCAAAAGCGTCACCATTGGCATCATTAAGAAGATCCCCGACGACGTCTATGCAGAGATTGTCTCCCACGCCCTC
TAG
Gene >Ophcf2|07299
ATGCCGAGCCCCGAACCCTCCTCCCCATCTCGCTCCTCCGCCGCCGCCGCCGCCGATCTTCACCCACCGCCCTCG
CCTCGGACGCATCGCGCCCTGCGCCGCCTGCAGTCAGCTCATAACCTCGGCTCGCCTTCGCCTTCGCTCATCGCT
CAGCAGCGTAGGGGCTTTTGCGGGAGCGCCTCGTCCAGCGAAGCCGGTCGTTCGCCTCAGAGGGGCCGCGCCTAT
AGCGATGCGACGTGCTCCCTGGACGGTAATGCCGCCAGGCGGTCTGTCGCCAAGAGGCCGGTTTTCTCGCATGGT
CATCTGTCGCTGCAGCATATCATTCGCGAGGGGCCCAATGATGGGGATTTCATCGGCGCGCTTGAGAGTGCGAGG
TGGAAGGTTGTAGATGAGGGCATCAAGAGCGCCGAGGATGGAATGGTGTGTTCTTTTCCCGTGTCTTTTGGCTCT
CCCTCACGGGGCCGTCCAGGCTGATTCCGATGCCCAGTCGACGCTGAGGATATACGTCTGGCTCGTCCTCCTTGA
CGCGCCCATCATGCCTACCGACGAATACCTGGGTCTCATCCATCGCGGTCCTTCGCCCGCCTACTCCAAGATCCG
CAACGATACCTTTCGTACCCTCACCACCGATCCTCTGTTTCGCCGGCGCGTCAGCGAGGCCAGTCTGATCCGTCT
CCTCAACGCCATCGCCTGGAAGCTACATGACGCCAAAGAGGATCAACGACAGAGCCGACCGAGCAGTCGCCAATC
CTCCCATCCTCGCGAAAGCCTCGTCGGCAGCGTCTCTGGCCACTCACAAGCGAGTAAGCCTCCATCTTATAACCC
CCCCCCCTCCCCCTGAGCCTCATCTCACATCTTCTTCTCAGAGTCCAGCGTCGGCCCGGAACCAGGCACTTACGT
CCAGGGCATGAACGTCCTCGCAGCGCCTTTTCTCTACGCCGCCCGCAGCGAGGCCGAAGCCTTCGTCGCCTTCCA
CTCGCTCCTCACGCGCGAGTGCCCAGCCTACATCCGAGGCGCCATGGACGGCGTCCACCGCGGCCTCGCCCTCGT
CGACAAGGTCCTTGCCATTGTCGACCCCAAGCTCAGCATGTACCTGACGGCCAAGGGACTGTCAGCCGAGATCTA
CGCTTTCCCCTCCGTCTTGACTCTCTGCGCTTGCACGCCGCCTCTGCCCGAGGTGTTGCGTCTCTGGGACTTTCT
CTTCGCTTACGGGCCGCATCTTAACATCGTCTGCATTGTCGCCCAGCTGACTATCATGAGGTCGCAGATCCTCCA
GTCTCCCAGGTGAGAGCAGAGCCGACTCTGAAGCTCCCACGACTTCCTCTTCAGTTTACTGACTCGGCTATCATC
TAGCCCCAACAAGGTGCTTCGATCGTTTCCGCAGTTGCACGCCCATCTCGTCAAAAGCGTCACCATTGGCATCAT
TAAGAAGATCCCCGACGACGTCTATGCAGAGATTGTCTCCCACGCCCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail