Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07294
Gene name
Locationscaffold_09:1151754..1153381
Strand-
Gene length (bp)1627
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17800 NPL Nucleoplasmin-like domain 9.9E-37 8 230
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 8.2E-24 395 483

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0016859 cis-trans isomerase activity No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4635 0.7137 0.1725 0.0227 0.0516 0.0009 0.1269 0.0049 0.0371 0.0133

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3215
Ophiocordyceps australis map64 (Brazil) OphauB2|2663
Ophiocordyceps camponoti-floridani Ophcf2|07294 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6860
Ophiocordyceps kimflemingae Ophio5|6372
Ophiocordyceps subramaniannii Hirsu2|1712

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07294
MSAIPGPVYGLEVPPGEVLIPATMDFPASFRITMAALDPTEEPEADEDGVVPSVCRSTLRLVKRPWPGMGLGDDE
DDEEIGDEYIKALLAESSDDDDDEPNGGPSDPAKAKEQKQAAAVKKLMEATMDEDEDADMQDAKPNGVKEKGVDK
AKGKGKGKAKALAKDEVSEQDSELASDDDVDEGDLENFVVCTLDTERNYQQPLNLSVNHGEKVFFVVTGTHTVHL
TGNYVMDDGDDESSDEDDDDYDLSPDELELAMGGDMSGDESDELDGVDHPRITEIEAEDDEEEIPELVKVPVKGK
NKRPAPESVGENLDEMMAKSEETKLSKKQQKKLKNNKGEAVAADDNKKDRKVQFAKNLEQGPAGDKGKQGGKDAK
LTKSVVQGVTIDDRVVGKGRTVKNGDTVGVRYIGKLANGNQFDANKRGNPFTSKAGKGQVVKGLDVGIMGMAVGG
ERRMVMPASMGYGSKTQPGIPANSPLTFDIKLLEIK*
Coding >Ophcf2|07294
ATGTCTGCTATTCCAGGTCCCGTTTACGGGCTCGAGGTGCCTCCGGGCGAGGTCCTGATTCCTGCCACCATGGAC
TTCCCTGCCTCTTTCCGCATCACCATGGCTGCACTGGACCCCACGGAAGAACCCGAGGCTGACGAGGACGGCGTC
GTTCCCTCCGTTTGCCGTTCCACTCTGCGCTTGGTCAAGCGCCCTTGGCCGGGCATGGGCCTTGGCGACGATGAA
GACGACGAGGAGATTGGTGACGAATACATCAAAGCGTTACTCGCTGAGTCTTCTGATGACGACGACGACGAGCCA
AATGGAGGTCCTAGCGATCCTGCCAAGGCAAAGGAGCAGAAGCAGGCTGCTGCCGTTAAGAAACTCATGGAGGCC
ACGATGGATGAGGACGAGGACGCAGACATGCAGGACGCCAAGCCCAACGGAGTCAAGGAAAAGGGCGTAGACAAG
GCTAAAGGCAAGGGCAAGGGTAAGGCAAAGGCCCTTGCCAAGGACGAGGTATCAGAGCAAGACTCAGAGCTTGCC
AGCGACGACGATGTTGACGAAGGTGACCTGGAGAACTTCGTCGTCTGCACCCTGGACACAGAGAGGAACTATCAA
CAACCGCTTAACCTCTCCGTCAACCACGGCGAGAAGGTCTTCTTTGTGGTTACCGGAACTCATACTGTTCACCTC
ACCGGGAACTATGTGATGGACGACGGTGACGACGAGAGCAGTGACGAGGATGACGATGACTATGATTTGTCTCCT
GACGAACTGGAGCTGGCCATGGGCGGTGACATGAGCGGCGACGAGAGCGATGAGCTTGATGGCGTCGACCACCCC
CGAATCACTGAGATCGAGGCAGAAGATGACGAGGAGGAGATCCCCGAGCTGGTCAAGGTCCCTGTCAAGGGCAAG
AACAAGCGTCCTGCCCCGGAATCGGTGGGCGAGAACTTGGATGAGATGATGGCCAAGTCGGAGGAGACCAAGCTT
TCCAAGAAGCAGCAAAAGAAGCTCAAGAACAACAAGGGCGAGGCCGTGGCGGCCGACGACAACAAGAAGGACAGG
AAGGTGCAGTTCGCCAAGAACCTCGAGCAAGGACCCGCAGGCGACAAGGGGAAGCAAGGCGGCAAAGACGCAAAA
TTAACCAAGTCAGTTGTCCAAGGCGTCACCATCGACGACCGGGTCGTGGGCAAGGGCCGCACGGTCAAGAACGGG
GACACTGTCGGCGTCCGGTACATTGGCAAACTGGCCAACGGCAACCAATTTGATGCCAATAAAAGGGGAAACCCT
TTTACTTCCAAGGCCGGAAAGGGCCAAGTAGTCAAGGGGCTTGACGTGGGCATCATGGGCATGGCCGTCGGTGGC
GAGAGACGCATGGTCATGCCTGCGAGCATGGGTTACGGGTCCAAGACTCAGCCCGGCATCCCGGCCAACAGCCCG
TTGACGTTTGACATTAAGCTCCTTGAGATCAAATGA
Transcript >Ophcf2|07294
ATGTCTGCTATTCCAGGTCCCGTTTACGGGCTCGAGGTGCCTCCGGGCGAGGTCCTGATTCCTGCCACCATGGAC
TTCCCTGCCTCTTTCCGCATCACCATGGCTGCACTGGACCCCACGGAAGAACCCGAGGCTGACGAGGACGGCGTC
GTTCCCTCCGTTTGCCGTTCCACTCTGCGCTTGGTCAAGCGCCCTTGGCCGGGCATGGGCCTTGGCGACGATGAA
GACGACGAGGAGATTGGTGACGAATACATCAAAGCGTTACTCGCTGAGTCTTCTGATGACGACGACGACGAGCCA
AATGGAGGTCCTAGCGATCCTGCCAAGGCAAAGGAGCAGAAGCAGGCTGCTGCCGTTAAGAAACTCATGGAGGCC
ACGATGGATGAGGACGAGGACGCAGACATGCAGGACGCCAAGCCCAACGGAGTCAAGGAAAAGGGCGTAGACAAG
GCTAAAGGCAAGGGCAAGGGTAAGGCAAAGGCCCTTGCCAAGGACGAGGTATCAGAGCAAGACTCAGAGCTTGCC
AGCGACGACGATGTTGACGAAGGTGACCTGGAGAACTTCGTCGTCTGCACCCTGGACACAGAGAGGAACTATCAA
CAACCGCTTAACCTCTCCGTCAACCACGGCGAGAAGGTCTTCTTTGTGGTTACCGGAACTCATACTGTTCACCTC
ACCGGGAACTATGTGATGGACGACGGTGACGACGAGAGCAGTGACGAGGATGACGATGACTATGATTTGTCTCCT
GACGAACTGGAGCTGGCCATGGGCGGTGACATGAGCGGCGACGAGAGCGATGAGCTTGATGGCGTCGACCACCCC
CGAATCACTGAGATCGAGGCAGAAGATGACGAGGAGGAGATCCCCGAGCTGGTCAAGGTCCCTGTCAAGGGCAAG
AACAAGCGTCCTGCCCCGGAATCGGTGGGCGAGAACTTGGATGAGATGATGGCCAAGTCGGAGGAGACCAAGCTT
TCCAAGAAGCAGCAAAAGAAGCTCAAGAACAACAAGGGCGAGGCCGTGGCGGCCGACGACAACAAGAAGGACAGG
AAGGTGCAGTTCGCCAAGAACCTCGAGCAAGGACCCGCAGGCGACAAGGGGAAGCAAGGCGGCAAAGACGCAAAA
TTAACCAAGTCAGTTGTCCAAGGCGTCACCATCGACGACCGGGTCGTGGGCAAGGGCCGCACGGTCAAGAACGGG
GACACTGTCGGCGTCCGGTACATTGGCAAACTGGCCAACGGCAACCAATTTGATGCCAATAAAAGGGGAAACCCT
TTTACTTCCAAGGCCGGAAAGGGCCAAGTAGTCAAGGGGCTTGACGTGGGCATCATGGGCATGGCCGTCGGTGGC
GAGAGACGCATGGTCATGCCTGCGAGCATGGGTTACGGGTCCAAGACTCAGCCCGGCATCCCGGCCAACAGCCCG
TTGACGTTTGACATTAAGCTCCTTGAGATCAAATGA
Gene >Ophcf2|07294
ATGTCTGCTATTCCAGGTCCCGTTTACGGGCTCGAGGTGCCTCCGGGCGAGGTCCTGATTCCTGCCACCATGGAC
TTCCCTGCCTCTGTAAGCTTCTTCATCTCCTTTACAGATGATCGATCCATAGACAGCTGACTTGGTTTTCAGTTC
CGCATCACCATGGCTGCACTGGACCCCACGGAAGAACCCGAGGCTGACGAGGACGGCGTCGTTCCCTCCGTTTGC
CGTTCCACTCTGCGCTTGGTCAAGCGCCCTTGGCCGGGCATGGGCCTTGGCGACGATGAAGACGACGAGGAGATT
GGTGACGAATACATCAAAGCGTTACTCGCTGAGTCTTCTGATGACGACGACGACGAGCCAAATGGAGGTCCTAGC
GATCCTGCCAAGGCAAAGGAGCAGAAGCAGGCTGCTGCCGTTAAGAAACTCATGGAGGCCACGATGGATGAGGAC
GAGGACGCAGACATGCAGGACGCCAAGCCCAACGGAGTCAAGGAAAAGGGCGTAGACAAGGCTAAAGGCAAGGGC
AAGGGTAAGGCAAAGGCCCTTGCCAAGGACGAGGTATCAGAGCAAGACTCAGAGCTTGCCAGCGACGACGATGTT
GACGAAGGTGACCTGGAGAACTTCGTCGTCTGCACCCTGGACACAGAGAGGGTGCGAGCCATTGGTGTGCTGGGC
TAAGACGACCTGCTGACGCTCCATCACAGAACTATCAACAACCGCTTAACCTCTCCGTCAACCACGGCGAGAAGG
TCTTCTTTGTGGTTACCGGAACTCATACTGTTCACCTCACCGGGAACTATGTGATGGACGACGGTGACGACGAGA
GCAGTGACGAGGATGACGATGACTATGATTTGTCTCCTGACGAACTGGAGCTGGCCATGGGCGGTGACATGAGCG
GCGACGAGAGCGATGAGCTTGATGGCGTCGACCACCCCCGAATCACTGAGATCGAGGCAGAAGATGACGAGGAGG
AGATCCCCGAGCTGGTCAAGGTCCCTGTCAAGGGCAAGAACAAGCGTCCTGCCCCGGAATCGGTGGGCGAGAACT
TGGATGAGATGATGGCCAAGTCGGAGGAGACCAAGCTTTCCAAGAAGCAGCAAAAGAAGCTCAAGAACAACAAGG
GCGAGGCCGTGGCGGCCGACGACAACAAGAAGGACAGGAAGGTGCAGTTCGCCAAGAACCTCGAGCAAGGACCCG
CAGGCGACAAGGGGAAGCAAGGCGGCAAAGACGCAAAATTAACCAAGTCAGTTGTCCAAGGCGTCACCATCGACG
ACCGGGTCGTGGGCAAGGGCCGCACGGTCAAGAACGGGGACACTGTCGGCGTCCGGTACATTGGCAAACTGGCCA
ACGGCAACCAATTTGATGGTGAGAGCGGCCCGCCCAAGCCAGCTGATGAACTCTCTGACTCCAGCCCACAGCCAA
TAAAAGGGGAAACCCTTTTACTTCCAAGGCCGGAAAGGGCCAAGTAGTCAAGGGGCTTGACGTGGGCATCATGGG
CATGGCCGTCGGTGGCGAGAGACGCATGGTCATGCCTGCGAGCATGGGTTACGGGTCCAAGACTCAGCCCGGCAT
CCCGGCCAACAGCCCGTTGACGTTTGACATTAAGCTCCTTGAGATCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail