Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07292
Gene name
Locationscaffold_09:1145700..1148381
Strand+
Gene length (bp)2681
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 410 429 19
2 439 461 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.19 31.16 79.22
Alive In ants, during behavior modification 31.18 16.52 45.83
Dead In ants, recently dead 28.17 14.79 41.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.003275 yes
Alive Dead 0.623092 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07292
MKALHALSQKPLGESRQPLLQKRILDVIGSEKLQARCRKNSGDITFHLGRLLGNVLAHLTQRTGEGVGGVRGEEV
VVRRDRFPPRDEEPRGGQFRQGAVVPPRTNPPNPKLLGPPPHLPLRPARLREIGLQMRLLRPRPQIVCLQEVWVS
SDYEAIREATRDVLPHGKLYRNGALGAGLAILSCWPFEESGMVGFALNGRPTAFWRGDWGGDVIHVFNTHTSTWI
PLPPPPHHHLPLPIHDLWRVIHPDSALGPAEALADGSVPSARFNLDVNGATSDGPYNTWRWTKNAQNSLRAGRRP
PPPVDPDAPDPKGKRLDYIFASVGPDSSWAVKSVAVTMTDPHPELSVSLSDHFAVSATLRRRSPTDDDDDESDQA
HDEDETSLPLSAYDEILAHIDTYTARERAQRRYRALHFYAALVVWATILVVAWFAPQRFAPFLLALVASLVLAAG
LIDGLLSLLFFSSELRSLQEFAWEVANARCVAASRSKLSP*
Coding >Ophcf2|07292
ATGAAAGCCCTCCATGCTCTCTCCCAGAAGCCCCTTGGCGAAAGCAGGCAACCTCTCCTTCAGAAACGCATCCTC
GACGTCATAGGCAGTGAAAAACTCCAAGCAAGGTGCCGAAAGAACAGCGGCGACATCACCTTCCACCTCGGCCGT
CTCCTCGGAAATGTCCTCGCCCACCTCACGCAGCGCACGGGTGAAGGCGTCGGTGGCGTCCGAGGCGAAGAAGTC
GTTGTGCGCAGGGACCGATTCCCACCGCGCGACGAGGAGCCACGAGGGGGGCAGTTCCGCCAGGGGGCCGTAGTA
CCCCCAAGAACTAACCCTCCTAACCCTAAACTGCTGGGGCCTCCGCCACATCTCCCCCTCCGCCCCGCCCGCCTC
CGCGAGATCGGCCTCCAGATGCGGCTCCTGCGGCCGCGGCCGCAGATAGTCTGCCTGCAAGAAGTGTGGGTGAGC
TCCGACTACGAGGCCATCCGCGAGGCCACGCGCGACGTGTTGCCGCACGGCAAGCTCTACCGCAACGGCGCGCTG
GGCGCGGGCCTCGCCATCCTCAGCTGCTGGCCGTTTGAGGAGAGCGGCATGGTGGGCTTCGCGCTTAACGGGAGG
CCTACGGCTTTTTGGAGGGGGGATTGGGGAGGGGATGTCATTCACGTCTTTAACACGCATACTTCAACATGGATC
CCTCTCCCTCCCCCACCGCATCATCACCTCCCGCTCCCCATCCACGACCTCTGGCGCGTAATCCACCCGGATAGC
GCCCTCGGTCCCGCAGAGGCCCTCGCAGACGGCTCCGTGCCGTCCGCCCGCTTCAACCTCGACGTCAACGGCGCG
ACGAGCGATGGCCCGTATAACACCTGGCGATGGACGAAGAATGCTCAGAATAGCCTTCGAGCTGGTCGTCGACCA
CCCCCCCCCGTTGACCCGGATGCTCCGGACCCGAAGGGAAAGCGGCTGGACTACATCTTCGCCTCCGTCGGCCCC
GACTCGTCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCTCTCTATCG
GATCACTTCGCCGTCAGCGCCACCCTCCGCCGTCGCTCCCCTACCGATGACGACGACGACGAATCCGACCAGGCC
CACGACGAGGACGAAACCTCGCTCCCCCTATCCGCCTACGATGAGATACTCGCCCACATCGACACTTACACCGCT
CGCGAGCGTGCTCAACGTCGATACCGCGCCTTGCACTTCTACGCCGCCCTCGTCGTCTGGGCCACCATCCTTGTC
GTCGCCTGGTTCGCCCCCCAACGCTTCGCCCCCTTCCTTCTCGCCCTCGTCGCGAGCCTCGTCCTCGCCGCCGGT
CTGATAGACGGCTTGCTCTCCCTGCTGTTCTTCTCATCCGAGCTGCGTAGCCTCCAAGAGTTCGCGTGGGAAGTC
GCCAACGCCAGATGCGTCGCCGCCAGTCGGTCCAAGCTCAGCCCATAG
Transcript >Ophcf2|07292
ATGAAAGCCCTCCATGCTCTCTCCCAGAAGCCCCTTGGCGAAAGCAGGCAACCTCTCCTTCAGAAACGCATCCTC
GACGTCATAGGCAGTGAAAAACTCCAAGCAAGGTGCCGAAAGAACAGCGGCGACATCACCTTCCACCTCGGCCGT
CTCCTCGGAAATGTCCTCGCCCACCTCACGCAGCGCACGGGTGAAGGCGTCGGTGGCGTCCGAGGCGAAGAAGTC
GTTGTGCGCAGGGACCGATTCCCACCGCGCGACGAGGAGCCACGAGGGGGGCAGTTCCGCCAGGGGGCCGTAGTA
CCCCCAAGAACTAACCCTCCTAACCCTAAACTGCTGGGGCCTCCGCCACATCTCCCCCTCCGCCCCGCCCGCCTC
CGCGAGATCGGCCTCCAGATGCGGCTCCTGCGGCCGCGGCCGCAGATAGTCTGCCTGCAAGAAGTGTGGGTGAGC
TCCGACTACGAGGCCATCCGCGAGGCCACGCGCGACGTGTTGCCGCACGGCAAGCTCTACCGCAACGGCGCGCTG
GGCGCGGGCCTCGCCATCCTCAGCTGCTGGCCGTTTGAGGAGAGCGGCATGGTGGGCTTCGCGCTTAACGGGAGG
CCTACGGCTTTTTGGAGGGGGGATTGGGGAGGGGATGTCATTCACGTCTTTAACACGCATACTTCAACATGGATC
CCTCTCCCTCCCCCACCGCATCATCACCTCCCGCTCCCCATCCACGACCTCTGGCGCGTAATCCACCCGGATAGC
GCCCTCGGTCCCGCAGAGGCCCTCGCAGACGGCTCCGTGCCGTCCGCCCGCTTCAACCTCGACGTCAACGGCGCG
ACGAGCGATGGCCCGTATAACACCTGGCGATGGACGAAGAATGCTCAGAATAGCCTTCGAGCTGGTCGTCGACCA
CCCCCCCCCGTTGACCCGGATGCTCCGGACCCGAAGGGAAAGCGGCTGGACTACATCTTCGCCTCCGTCGGCCCC
GACTCGTCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCTCTCTATCG
GATCACTTCGCCGTCAGCGCCACCCTCCGCCGTCGCTCCCCTACCGATGACGACGACGACGAATCCGACCAGGCC
CACGACGAGGACGAAACCTCGCTCCCCCTATCCGCCTACGATGAGATACTCGCCCACATCGACACTTACACCGCT
CGCGAGCGTGCTCAACGTCGATACCGCGCCTTGCACTTCTACGCCGCCCTCGTCGTCTGGGCCACCATCCTTGTC
GTCGCCTGGTTCGCCCCCCAACGCTTCGCCCCCTTCCTTCTCGCCCTCGTCGCGAGCCTCGTCCTCGCCGCCGGT
CTGATAGACGGCTTGCTCTCCCTGCTGTTCTTCTCATCCGAGCTGCGTAGCCTCCAAGAGTTCGCGTGGGAAGTC
GCCAACGCCAGATGCGTCGCCGCCAGTCGGTCCAAGCTCAGCCCATAG
Gene >Ophcf2|07292
ATGAAAGCCCTCCATGCTCTCTCCCAGAAGCCCCTTGGCGAAAGCAGGCAACCTCTCCTTCAGAAACGCATCCTC
GACGTCATAGGCAGTGAAAAACTCCAAGCAAGGTGCCGAAAGAACAGCGGCGACATCACCTTCCACCTCGGCCGT
CTCCTCGGAAATGTCCTCGCCCACCTCACGCAGCGCACGGGTGAAGGCGTCGGTGGCGTCCGAGGCGAAGAAGTC
GTTGTGCGCAGGGACCGATTCCCACCGCGCGACGAGGAGCCACGAGGGGGGCAGTTCCGCCAGGGGGCCGTAGTG
TAGGCTCGTGAGGCCTGGGGCGGAGAGGAGGGCGCTGCAGGTGGTTTGGAGGGAGGCGGGGGGGAGTCGGGGGTG
GGTTGGAGGGAGGGTTTGAAGTGGAGGGTGATGAGGGTGAGGGTTGTGGTGGCCATGGTGAGAGGTGGGGAGAGG
TGGGTGGTGGTGATGGTCAGAGATGGTCAGAGATGGTCAGAGATGGTTAGAGATGGTTAGTGATGGTTGGTGATA
GTTAGTGATAGTTAGTGGTGAAGGTCAGACTTGGTGGTGAAGATGGTGGAGGAGAGCTTGAGGGGTTAGTCCGGA
TGGATTATGTAAATACTTGTACATGATAAACGATACATATGTATGGTATGGTATAGTGGGCTGCCACTCAAAACG
AGCAAATCTTAACACCATCACTGCTCTATAGTAAGACACTTAGTTAAGATAGGCCTCGCCTGCAAAGCCAACCCC
GCTAGATTTAGCTGTCCCGGCTCCCCTCTGCCAAGTCCCCGTGTCCCCCGCGTGACGCGCTTAGCATTCCATCGC
TAGCACTAGGGTCTTCCCGTACATATGTATGTACGTACATACGCCTACAGTCCCGCCTTTTCCTTTCTTCACGAT
AACCATCGCCCTTACTCTTGTACATACACGCTCTCGTACACGCTCTCGCTCGCCTTGGCACGTGATCCCCCCTCT
CGATAACAATACCGATAACTAGGATGAAGAAGACTACAATACGGGCTACGTACGGCGCACGCGCGAAGATGACGA
CGATGCTAGCTTACGCGAGACGTCTCATTGAGTGAAGGCTACGAGTCTAAGAAGTCGTTCGTCCCCCGGAGTCCG
CGACAAGATTATTCCGCCGCCTATCAATCTAGCCCAATCCGGCAACTCGAACCCCAATCTCAACCATCATCAACA
CCATCACCAAACCTCGACTCAACCATAAAAACAGCACAATGCCCCCCAAAGACCCCCAAGAACTAACCCTCCTAA
CCCTAAACTGCTGGGGCCTCCGCCACATCTCCCCCTCCGCCCCGCCCGCCTCCGCGAGATCGGCCTCCAGATGCG
GCTCCTGCGGCCGCGGCCGCAGATAGTCTGCCTGCAAGAAGTGTGGGTGAGCTCCGACTACGAGGCCATCCGCGA
GGCCACGCGCGACGTGTTGCCGCACGGCAAGCTCTACCGCAACGGCGCGCTGGGCGCGGGCCTCGCCATCCTCAG
CTGCTGGCCGTTTGAGGAGAGCGGCATGGTGGGCTTCGCGCTTAACGGGAGGCCTACGGCTTTTTGGAGGGGGGA
TTGGTTTGTTGGGAAGGGGTTGCCTGTGCGGTTTTGAGGGTTGGGGAGGGGAGGGGATGTCATTCACGTCTTTAA
CACGCATGTAAGTCGTCCTCGTCCTCGTCCTCGTCCTCGTCACCATCACCATCACCATCACAGCTAACCTTCTGG
CCCCCTTCCCCCCAGACACACCCCCCTACGCCCCCCCAACACCCCTTCGACCTACACCTGCCACCGCCTCTCCCA
AGCCTGGCAAATCGCCAAGCTCCTCCGCACCTCGACACGAACCCAGGCCCTGACCCTCGCCCTCGGAGACTTCAA
CATGGATCCCTCTCCCTCCCCCACCGCATCATCACCTCCCGCTCCCCATCCACGACCTCTGGCGCGTAATCCACC
CGGATAGCGCCCTCGGTCCCGCAGAGGCCCTCGCAGACGGCTCCGTGCCGTCCGCCCGCTTCAACCTCGACGTCA
ACGGCGCGACGAGCGATGGCCCGTATAACACCTGGCGATGGACGAAGAATGCTCAGAATAGCCTTCGAGCTGGTC
GTCGACCACCCCCCCCCGTTGACCCGGATGCTCCGGACCCGAAGGGAAAGCGGCTGGACTACATCTTCGCCTCCG
TCGGCCCCGACTCGTCATGGGCCGTCAAGTCCGTCGCCGTCACCATGACAGACCCCCATCCCGAACTATCCGTCT
CTCTATCGGATCACTTCGCCGTCAGCGCCACCCTCCGCCGTCGCTCCCCTACCGATGACGACGACGACGAATCCG
ACCAGGCCCACGACGAGGACGAAACCTCGCTCCCCCTATCCGCCTACGATGAGATACTCGCCCACATCGACACTT
ACACCGCTCGCGAGCGTGCTCAACGTCGATACCGCGCCTTGCACTTCTACGCCGCCCTCGTCGTCTGGGCCACCA
TCCTTGTCGTCGCCTGGTTCGCCCCCCAACGCTTCGCCCCCTTCCTTCTCGCCCTCGTCGCGAGCCTCGTCCTCG
CCGCCGGTCTGATAGACGGCTTGCTCTCCCTGCTGTTCTTCTCATCCGAGCTGCGTAGCCTCCAAGAGTTCGCGT
GGGAAGTCGCCAACGCCAGATGCGTCGCCGCCAGTCGGTCCAAGCTCAGCCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail