Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07290
Gene name
Locationscaffold_09:1140451..1142008
Strand+
Gene length (bp)1557
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 5.7E-09 132 184
PF00013 KH_1 KH domain 4.3E-12 207 267
PF00013 KH_1 KH domain 1.3E-17 403 466

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3925 0.8823 0.2951 0.035 0.0968 0.0005 0.0508 0.0118 0.0221 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2953
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4566
Ophiocordyceps australis map64 (Brazil) OphauB2|5585
Ophiocordyceps camponoti-floridani Ophcf2|07290 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|282
Ophiocordyceps kimflemingae Ophio5|1927
Ophiocordyceps subramaniannii Hirsu2|5000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07290
MSASPPQPTQSAKRPLEEASSPSRATDQPDAKRPALDKVIKTDEDIAETADATLDVPGQASNDESTGAHSDHSAA
AAAAAAAAAAAAAPSVVPATAAATAVVAASDAAVSSAAANDETIWIHIRAVISSPEAATIIGKGGENVSNIRKMS
GAKCTVSDYQKGAVERILTVSGIVDAVAKAFGLIIRTLNNEPLNEKSTTASKTYPLRLLIPHILIGSIIGKGGAR
IKEIQDASGARLNASDSCLPMSSERSLVVMGVADAVHIATYYVGSTLLEQLNERFGGPAASAYATRSGAPVGSIP
GGMQVVPYSPQPAGGHFGRSDNYGRHQDRRPNHQVPPAPYGQQYGHGAAQPNATMPMHYGGQAAAYGASPHAQPH
MAHHGGQQPHGGPQGQQMHTAMAGGPITQQIYIPNDMVGAIIGKGGQKINEIRQLSGSVIKINEPQDNSNERLVT
VTGTEECNRMALYLLYSRLESEKHRI*
Coding >Ophcf2|07290
ATGTCTGCGTCGCCACCGCAGCCGACGCAATCGGCCAAGCGCCCGCTCGAGGAGGCCTCTTCGCCCTCGCGTGCC
ACCGATCAGCCCGATGCCAAACGACCCGCTCTTGACAAGGTCATCAAGACGGACGAAGACATCGCCGAAACGGCC
GACGCCACGCTCGACGTCCCTGGCCAGGCCAGCAACGATGAGTCTACCGGCGCCCACTCTGACCACTCCGCCGCC
GCTGCCGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCGCGCCCTCGGTCGTGCCGGCCACCGCTGCTGCCACGGCT
GTCGTGGCCGCTTCCGATGCTGCCGTGAGCTCTGCCGCGGCCAACGACGAAACTATCTGGATTCATATCCGTGCC
GTCATCTCGAGCCCCGAGGCCGCCACCATCATTGGCAAGGGTGGCGAAAATGTTTCCAACATCCGAAAGATGTCA
GGCGCCAAGTGCACCGTGAGCGACTATCAGAAGGGGGCTGTTGAGCGAATCCTCACAGTGAGCGGCATTGTCGAC
GCCGTCGCCAAGGCCTTTGGCCTCATCATTCGAACGCTCAACAACGAGCCCCTCAATGAAAAGTCGACGACGGCT
TCCAAGACGTACCCGCTGCGTCTCCTGATCCCCCATATCCTCATTGGTTCCATCATCGGCAAGGGCGGGGCTCGC
ATCAAGGAGATCCAGGACGCTTCGGGCGCCCGGCTCAACGCGTCCGACTCTTGCCTCCCCATGTCGAGTGAGCGG
TCCCTCGTCGTTATGGGCGTCGCGGACGCCGTTCACATCGCAACTTACTACGTCGGCAGCACCCTGCTGGAGCAG
CTCAACGAGCGCTTCGGCGGTCCGGCTGCCTCGGCCTACGCCACGCGCAGCGGCGCGCCCGTCGGATCCATCCCC
GGCGGCATGCAGGTTGTCCCTTACTCGCCCCAGCCGGCGGGTGGACACTTTGGCCGCTCCGACAACTATGGACGC
CACCAGGACCGACGGCCCAACCACCAGGTGCCTCCGGCGCCCTACGGTCAGCAGTACGGACACGGGGCGGCCCAG
CCCAACGCGACCATGCCCATGCACTACGGCGGCCAGGCGGCGGCCTACGGCGCCAGCCCCCATGCGCAGCCTCAC
ATGGCTCACCACGGCGGCCAGCAGCCCCACGGTGGCCCCCAGGGACAGCAGATGCACACGGCAATGGCTGGCGGG
CCCATCACGCAACAGATATACATCCCCAACGATATGGTCGGAGCCATCATCGGTAAAGGCGGTCAGAAGATTAAC
GAAATCAGACAACTAAGCGGCAGCGTTATAAAAATAAACGAGCCGCAAGACAACAGCAATGAGCGGTTGGTGACT
GTGACCGGAACTGAAGAGTGCAATCGTATGGCGTTGTACCTTCTTTATTCGCGTCTCGAGTCCGAGAAACACCGA
ATTTAA
Transcript >Ophcf2|07290
ATGTCTGCGTCGCCACCGCAGCCGACGCAATCGGCCAAGCGCCCGCTCGAGGAGGCCTCTTCGCCCTCGCGTGCC
ACCGATCAGCCCGATGCCAAACGACCCGCTCTTGACAAGGTCATCAAGACGGACGAAGACATCGCCGAAACGGCC
GACGCCACGCTCGACGTCCCTGGCCAGGCCAGCAACGATGAGTCTACCGGCGCCCACTCTGACCACTCCGCCGCC
GCTGCCGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCGCGCCCTCGGTCGTGCCGGCCACCGCTGCTGCCACGGCT
GTCGTGGCCGCTTCCGATGCTGCCGTGAGCTCTGCCGCGGCCAACGACGAAACTATCTGGATTCATATCCGTGCC
GTCATCTCGAGCCCCGAGGCCGCCACCATCATTGGCAAGGGTGGCGAAAATGTTTCCAACATCCGAAAGATGTCA
GGCGCCAAGTGCACCGTGAGCGACTATCAGAAGGGGGCTGTTGAGCGAATCCTCACAGTGAGCGGCATTGTCGAC
GCCGTCGCCAAGGCCTTTGGCCTCATCATTCGAACGCTCAACAACGAGCCCCTCAATGAAAAGTCGACGACGGCT
TCCAAGACGTACCCGCTGCGTCTCCTGATCCCCCATATCCTCATTGGTTCCATCATCGGCAAGGGCGGGGCTCGC
ATCAAGGAGATCCAGGACGCTTCGGGCGCCCGGCTCAACGCGTCCGACTCTTGCCTCCCCATGTCGAGTGAGCGG
TCCCTCGTCGTTATGGGCGTCGCGGACGCCGTTCACATCGCAACTTACTACGTCGGCAGCACCCTGCTGGAGCAG
CTCAACGAGCGCTTCGGCGGTCCGGCTGCCTCGGCCTACGCCACGCGCAGCGGCGCGCCCGTCGGATCCATCCCC
GGCGGCATGCAGGTTGTCCCTTACTCGCCCCAGCCGGCGGGTGGACACTTTGGCCGCTCCGACAACTATGGACGC
CACCAGGACCGACGGCCCAACCACCAGGTGCCTCCGGCGCCCTACGGTCAGCAGTACGGACACGGGGCGGCCCAG
CCCAACGCGACCATGCCCATGCACTACGGCGGCCAGGCGGCGGCCTACGGCGCCAGCCCCCATGCGCAGCCTCAC
ATGGCTCACCACGGCGGCCAGCAGCCCCACGGTGGCCCCCAGGGACAGCAGATGCACACGGCAATGGCTGGCGGG
CCCATCACGCAACAGATATACATCCCCAACGATATGGTCGGAGCCATCATCGGTAAAGGCGGTCAGAAGATTAAC
GAAATCAGACAACTAAGCGGCAGCGTTATAAAAATAAACGAGCCGCAAGACAACAGCAATGAGCGGTTGGTGACT
GTGACCGGAACTGAAGAGTGCAATCGTATGGCGTTGTACCTTCTTTATTCGCGTCTCGAGTCCGAGAAACACCGA
ATTTAA
Gene >Ophcf2|07290
ATGTCTGCGTCGCCACCGCAGCCGACGCAATCGGCCAAGCGCCCGCTCGAGGAGGCCTCTTCGCCCTCGCGTGCC
ACCGATCAGCCCGATGCCAAACGACCCGCTCTTGACAAGGTCATCAAGACGGACGAAGACATCGCCGAAACGGCC
GACGCCACGCTCGACGTCCCTGGCCAGGCCAGCAACGATGAGTCTACCGGCGCCCACTCTGACCACTCCGCCGCC
GCTGCCGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCGCGCCCTCGGTCGTGCCGGCCACCGCTGCTGCCACGGCT
GTCGTGGCCGCTTCCGATGCTGCCGTGAGCTCTGCCGCGGCCAACGACGAAACTATCTGGATTCATATCCGTGCC
GTCATCTCGAGCCCCGAGGCCGCCACCATCATTGGCAAGGGTGGCGAAAATGTTTCCAACATCCGAAAGATGTCA
GGCGCCAAGTGCACCGTGAGCGACTATCAGAAGGGGGCTGTTGAGCGAATCCTCACAGTGAGCGGCATTGTCGAC
GCCGTCGCCAAGGCAAGCCAAGTAGTCTCTTCGACAGTCGAAGCTTGTATGGGCTAACCGTGCTATCGCAGGCCT
TTGGCCTCATCATTCGAACGCTCAACAACGAGCCCCTCAATGAAAAGTCGACGACGGCTTCCAAGACGTACCCGC
TGCGTCTCCTGATCCCCCATATCCTCATTGGTTCCATCATCGGCAAGGGCGGGGCTCGCATCAAGGAGATCCAGG
ACGCTTCGGGCGCCCGGCTCAACGCGTCCGACTCTTGCCTCCCCATGTCGAGTGAGCGGTCCCTCGTCGTTATGG
GCGTCGCGGACGCCGTTCACATCGCAACTTACTACGTCGGCAGCACCCTGCTGGAGCAGCTCAACGAGCGCTTCG
GCGGTCCGGCTGCCTCGGCCTACGCCACGCGCAGCGGCGCGCCCGTCGGATCCATCCCCGGCGGCATGCAGGTTG
TCCCTTACTCGCCCCAGCCGGCGGGTGGACACTTTGGCCGCTCCGACAACTATGGACGCCACCAGGACCGACGGC
CCAACCACCAGGTGCCTCCGGCGCCCTACGGTCAGCAGTACGGACACGGGGCGGCCCAGCCCAACGCGACCATGC
CCATGCACTACGGCGGCCAGGCGGCGGCCTACGGCGCCAGCCCCCATGCGCAGCCTCACATGGCTCACCACGGCG
GCCAGCAGCCCCACGGTGGCCCCCAGGGACAGCAGATGCACACGGCAATGGCTGGCGGGCCCATCACGCAACAGA
TATACATCCCCAACGATATGGTCGGAGCCATCATCGGTAAAGGCGGTCAGAAGATTAACGAAATCAGACAACTAA
GCGGCAGCGTTATAAAAATAAACGAGCCGCAAGACAACAGCAATGAGCGGTTGGTGACTGTGACCGGAACTGAAG
AGTGCAATCGTATGGCGTTGTACCTTCTTTATTCGCGTCTCGGTATGCTTCCATTCCAGACTCCTGCTTACTCTC
CCCGTCGGAAGAGTCTGACAAAGAGCCTTCTCAGAGTCCGAGAAACACCGAATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail