Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07285
Gene name
Locationscaffold_09:1131889..1133303
Strand+
Gene length (bp)1414
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain 7.0E-56 69 192
PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain 2.0E-48 195 322
PF04139 Rad9 Rad9 8.8E-06 82 284

GO

GO Term Description Terminal node
GO:0006275 regulation of DNA replication Yes
GO:0000077 DNA damage checkpoint signaling Yes
GO:0030896 checkpoint clamp complex Yes
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0031323 regulation of cellular metabolic process No
GO:0051052 regulation of DNA metabolic process No
GO:0032991 protein-containing complex No
GO:0005488 binding No
GO:0051716 cellular response to stimulus No
GO:0010564 regulation of cell cycle process No
GO:1901988 negative regulation of cell cycle phase transition No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:1901987 regulation of cell cycle phase transition No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0031570 DNA integrity checkpoint signaling No
GO:0097159 organic cyclic compound binding No
GO:0048519 negative regulation of biological process No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0007165 signal transduction No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0045786 negative regulation of cell cycle No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0065007 biological regulation No
GO:0006950 response to stress No
GO:0051726 regulation of cell cycle No
GO:0019222 regulation of metabolic process No
GO:0000075 cell cycle checkpoint signaling No
GO:0050896 response to stimulus No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003674 molecular_function No
GO:0042770 signal transduction in response to DNA damage No
GO:0140513 nuclear protein-containing complex No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0010948 negative regulation of cell cycle process No
GO:0035556 intracellular signal transduction No
GO:0048523 negative regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5324 0.7125 0.0678 0.1242 0.1401 0.1191 0.2023 0.0798 0.0756 0.049

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup328
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1774
Ophiocordyceps australis 1348a (Ghana) OphauG2|2226
Ophiocordyceps australis map64 (Brazil) OphauB2|5589
Ophiocordyceps australis map64 (Brazil) OphauB2|5590
Ophiocordyceps camponoti-floridani Ophcf2|07285 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07286
Ophiocordyceps camponoti-rufipedis Ophun1|278
Ophiocordyceps kimflemingae Ophio5|1931
Ophiocordyceps subramaniannii Hirsu2|345
Ophiocordyceps subramaniannii Hirsu2|346

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07285
MRRLSPISIPYPIHIQSIWPNWNNKSPANGQCGPATRRVEVARVKCLPFHLWLFLSFPFSATDSSRHEMLEARLE
QANILKKLVDSIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRCDRNIPLGVNLASLTKVLRAA
QNEDILTLKAQDAPDVLNLVFESSENDRISEYDLKLMDIDQEHLGIPDTEYAASITMPAAEFRRICTDLAAMSES
VSIEASKDGIKFACNGDIGNGSVVLRSHTNVDKPELNVDIELTDPVSLTFSLKYLVNFCKASSLSNTVKLCLSSE
VPLLVEYNLSGSSYLRFYLAPKIGDEE*
Coding >Ophcf2|07285
ATGCGGCGCCTAAGCCCCATATCCATCCCATATCCAATCCATATCCAATCCATCTGGCCGAATTGGAATAATAAA
AGTCCGGCCAACGGTCAGTGTGGCCCCGCCACGCGACGCGTCGAGGTGGCGCGTGTAAAGTGCCTGCCCTTTCAC
CTGTGGCTTTTTCTTTCTTTTCCCTTTTCTGCCACCGATTCATCGCGACACGAAATGTTGGAGGCACGACTCGAA
CAGGCTAACATCCTCAAAAAGTTGGTGGACTCTATCAAGGACCTCGTTCAGGACTGCAACTTCGACTGCAATGAT
TCGGGCATCGCCCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCCATGATGCTCAAGGCGGAGGGCTTC
TCGCCCTACCGATGCGACCGCAACATCCCGCTTGGCGTCAACCTCGCGTCTCTGACAAAAGTGCTGCGGGCGGCG
CAAAACGAGGATATCCTGACGCTCAAGGCGCAGGATGCGCCCGACGTGCTCAACCTGGTCTTTGAGAGCAGCGAG
AACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGATATTGATCAGGAGCATCTGGGCATTCCGGATACGGAG
TACGCGGCGTCGATTACGATGCCGGCGGCCGAGTTCCGGAGAATCTGCACTGATCTGGCAGCCATGTCGGAGTCA
GTGAGTATCGAGGCTAGCAAGGACGGCATCAAGTTTGCGTGCAACGGCGACATTGGCAACGGCTCCGTCGTTCTC
CGGAGTCACACCAACGTCGACAAGCCCGAGCTCAACGTCGACATTGAGCTGACGGACCCCGTCTCGCTGACGTTT
TCGCTCAAGTACCTTGTCAATTTCTGCAAGGCTTCTTCTCTCTCCAACACGGTCAAGCTGTGCCTGTCGAGCGAG
GTGCCGCTGCTGGTGGAGTACAACTTGTCGGGCAGCAGCTACTTGCGCTTCTACCTGGCGCCAAAGATTGGCGAC
GAAGAGTAA
Transcript >Ophcf2|07285
ATGCGGCGCCTAAGCCCCATATCCATCCCATATCCAATCCATATCCAATCCATCTGGCCGAATTGGAATAATAAA
AGTCCGGCCAACGGTCAGTGTGGCCCCGCCACGCGACGCGTCGAGGTGGCGCGTGTAAAGTGCCTGCCCTTTCAC
CTGTGGCTTTTTCTTTCTTTTCCCTTTTCTGCCACCGATTCATCGCGACACGAAATGTTGGAGGCACGACTCGAA
CAGGCTAACATCCTCAAAAAGTTGGTGGACTCTATCAAGGACCTCGTTCAGGACTGCAACTTCGACTGCAATGAT
TCGGGCATCGCCCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCCATGATGCTCAAGGCGGAGGGCTTC
TCGCCCTACCGATGCGACCGCAACATCCCGCTTGGCGTCAACCTCGCGTCTCTGACAAAAGTGCTGCGGGCGGCG
CAAAACGAGGATATCCTGACGCTCAAGGCGCAGGATGCGCCCGACGTGCTCAACCTGGTCTTTGAGAGCAGCGAG
AACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGATATTGATCAGGAGCATCTGGGCATTCCGGATACGGAG
TACGCGGCGTCGATTACGATGCCGGCGGCCGAGTTCCGGAGAATCTGCACTGATCTGGCAGCCATGTCGGAGTCA
GTGAGTATCGAGGCTAGCAAGGACGGCATCAAGTTTGCGTGCAACGGCGACATTGGCAACGGCTCCGTCGTTCTC
CGGAGTCACACCAACGTCGACAAGCCCGAGCTCAACGTCGACATTGAGCTGACGGACCCCGTCTCGCTGACGTTT
TCGCTCAAGTACCTTGTCAATTTCTGCAAGGCTTCTTCTCTCTCCAACACGGTCAAGCTGTGCCTGTCGAGCGAG
GTGCCGCTGCTGGTGGAGTACAACTTGTCGGGCAGCAGCTACTTGCGCTTCTACCTGGCGCCAAAGATTGGCGAC
GAAGAGTAA
Gene >Ophcf2|07285
ATGCGGCGCCTAAGCCCCATATCCATCCCATATCCAATCCATATCCAATCCATCTGGCCGAATTGGAATAATAAA
AGTCCGGCCAACGGTCAGTGTGGCCCCGCCACGCGACGCGTCGAGGTGGCGCGTGTAAAGTGCCTGCCCTTTCAC
CTGTGGCTTTTTCTTTCTTTTCCCTTTTCTGCCACCGATTCATCGCGACGTCAACTCAGCCTCGACTCAACAGGA
ACAGAGTGTCATCCATCATCTTTCGTCTTGTTGTATCGAAGCCTATAAAGACGCTCTTGCCCAGTCTCTACCAGC
CGTGCCCCCTGCCTCGGTCTTGTCTCTCTTGGAGCTCTCTTGACCCGCCTCCTCGTGTCGAGCACGCGACGCAGA
GACTGTCTACTCGTCTTTTCCTGATATAGACTCATCTAGACGGTTGGTAGTTCGCCTGGGCCTCCTATATGCAGG
CGGTAACGCTGACAGAAGTGCAGAAATGTTGGAGGCACGACTCGAACAGGCTAACATCCTCAAAAAGGTGATTAC
CCTCTGCCTCGCTCATAGCCCGCGCGGCCGCTGACAGGTGATCAGTTGGTGGACTCTATCAAGGACCTCGTTCAG
GACTGCAACTTCGACTGCAATGATTCGGGCATCGCCCTCCAGGCCATGGACAACTCGCACGTCGCCCTCGTGTCC
ATGATGCTCAAGGCGGAGGGCTTCTCGCCCTACCGATGCGACCGCAACATCCCGCTTGGCGTCAACCTCGCGTCT
CTGACAAAAGTGCTGCGGGCGGCGCAAAACGAGGATATCCTGACGCTCAAGGCGCAGGATGCGCCCGACGTGCTC
AACCTGGTCTTTGAGAGCAGCGAGAACGACCGGATCAGCGAGTACGACTTGAAGCTCATGGATATTGATCAGGAG
CATCTGGGCATTCCGGATACGGAGTACGCGGCGTCGATTACGATGCCGGCGGCCGAGTTCCGGAGAATCTGCACT
GATCTGGCAGCCATGTCGGAGTCAGGTACGACTTCGCGAGACGAATTGTTGGTGACGGATTGCTGATTTGTTGTT
ACAGTGAGTATCGAGGCTAGCAAGGACGGCATCAAGTTTGCGTGCAACGGCGACATTGGCAACGGCTCCGTCGTT
CTCCGGAGTCACACCAACGTCGACAAGCCCGAGCTCAACGTCGACATTGAGCTGACGGACCCCGTCTCGCTGACG
TTTTCGCTCAAGTACCTTGTCAATTTCTGCAAGGCTTCTTCTCTCTCCAACACGGTCAAGCTGTGCCTGTCGAGC
GAGGTGCCGCTGCTGGTGGAGTACAACTTGTCGGGCAGCAGCTACTTGCGCTTCTACCTGGCGCCAAAGGTGCGT
CGACTGGTTGTATTGTTTGCGTGTTTTAGCTGCTAACAGCTGGCAGATTGGCGACGAAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail