Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07284
Gene name
Locationscaffold_09:1129458..1131562
Strand+
Gene length (bp)2104
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12632 Vezatin Mysoin-binding motif of peroxisomes 8.9E-66 163 442

GO

GO Term Description Terminal node
GO:0017022 myosin binding Yes
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0005515 protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 184 203 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07284
MEPIVYQKTPLADYLRDGGDGSDSEWAAGDSPPSRAPSSPSTLPSPPYSPSPVAPFAPSGRPLVKRRFRARSPPA
SRPVEPQVVSFLGAVRTRLWAALTASIHDSDHAKFLEQFRYTIIASQLLSGHSTSSHRSGPAVPTLDDRDQPLLS
TEGVVVPVLGALAVAAFLNWLRGSGALSTMNRKRVALVVAALALSAFLSRAHMRRQWLRYRRDQTLSEMTALVIN
SRDFDSATEATLSLVQEVELVSRGYRISAPLPPISRLEDRSQNRKCVRLRKVLKDSLSDALTKYTQASSDVKALS
EQTELEKYYDLYDVGDFDISDALQGFCETEFEDPESVRSLKILAARFLTTRKMILCALLALDASDEATELLRWGA
AYEVLRGLNATIRAGYEGLKATLADEAAFPVPPSPKEPLSPGRERWRSQWRKLDSLSTGIRGLQAKLHLLREESD
RALDGSDDISRLGPHLSSQYESIGVDLRQLMAAWEEGKAALALGIDRNERRLSSRSSMLSPTGSLSGLTTVDEGG
DALDALKALTGESPLPSEAEAAEVLEAVARPRPRSLLTREERIVKMREDREQKAQARQQFDATRGMLRELESVIS
LRPRSRLSAPPLGGKRVTSM*
Coding >Ophcf2|07284
ATGGAGCCCATCGTCTATCAGAAGACGCCTCTGGCCGACTATCTACGAGATGGAGGAGACGGATCCGACTCGGAA
TGGGCTGCTGGTGACAGCCCGCCTTCGCGAGCTCCCTCGTCCCCCTCGACGCTGCCTTCGCCGCCTTACAGTCCT
TCGCCTGTCGCTCCTTTTGCGCCATCCGGTCGTCCTCTTGTGAAGCGTCGCTTTCGAGCTCGTTCGCCGCCCGCC
TCACGTCCGGTCGAGCCACAGGTCGTGTCATTCCTGGGGGCCGTCAGGACCAGACTTTGGGCTGCCTTGACCGCC
TCCATTCACGACTCCGATCATGCCAAGTTTCTTGAACAGTTTCGATACACCATCATCGCCTCGCAGCTGCTGAGC
GGGCACTCCACCTCGAGTCACCGCTCCGGACCCGCCGTGCCGACGCTCGATGATCGAGACCAGCCGCTCCTCTCC
ACCGAGGGCGTCGTTGTGCCTGTACTGGGCGCTCTCGCCGTCGCCGCCTTCCTCAACTGGCTCCGCGGCAGTGGT
GCGCTTTCCACCATGAACCGCAAGCGTGTGGCTCTCGTCGTAGCCGCTCTCGCCCTCTCGGCTTTTCTGAGTCGC
GCCCACATGAGGAGACAGTGGCTGCGCTATCGTCGAGACCAGACCCTCTCTGAGATGACGGCCTTGGTCATCAAC
TCCCGGGACTTTGACAGCGCCACCGAAGCCACCCTGTCCTTGGTTCAAGAGGTGGAGCTGGTCTCGCGCGGTTAT
CGAATCAGCGCGCCTTTGCCTCCCATAAGCCGGCTGGAGGACCGGAGCCAGAATCGTAAATGCGTTCGCCTGCGC
AAGGTGCTCAAAGACTCTCTGAGCGACGCCCTCACCAAGTATACCCAGGCGTCCAGCGATGTCAAGGCCTTGTCC
GAGCAGACGGAGCTCGAAAAGTACTATGACCTGTACGACGTCGGAGACTTTGACATATCCGACGCCCTCCAGGGC
TTCTGCGAGACCGAATTCGAAGACCCAGAGTCGGTGCGGAGCCTCAAGATCCTGGCGGCCCGCTTCCTCACCACG
CGAAAGATGATACTCTGCGCGCTGCTGGCCCTAGACGCCAGCGATGAAGCGACGGAGCTCCTACGCTGGGGCGCC
GCTTACGAGGTGCTTCGGGGTCTCAACGCCACCATCAGGGCTGGCTACGAAGGGCTGAAGGCGACCTTGGCCGAC
GAAGCGGCTTTTCCCGTCCCGCCCTCTCCCAAGGAACCCCTGTCACCGGGCAGGGAGCGATGGCGGTCGCAGTGG
CGGAAGCTCGACTCGCTATCGACGGGTATCCGAGGCCTGCAGGCCAAACTTCATCTGCTGAGGGAGGAGTCGGAC
AGGGCCTTGGACGGCTCCGATGACATCTCGCGGCTGGGGCCGCACCTTTCGTCTCAGTACGAATCCATCGGCGTC
GACCTCCGGCAGCTCATGGCGGCGTGGGAAGAAGGCAAGGCTGCGCTGGCTCTCGGCATCGATAGGAACGAGAGG
AGGCTTTCGTCGAGGAGCTCCATGCTTTCGCCGACGGGATCGCTGAGCGGACTGACGACGGTGGACGAAGGCGGC
GACGCTTTGGACGCGCTCAAGGCACTGACGGGCGAGTCACCGCTACCGTCAGAGGCGGAGGCGGCCGAGGTGCTC
GAGGCGGTGGCCCGGCCCCGGCCCCGGAGCCTGCTGACGCGGGAAGAACGCATCGTCAAGATGAGGGAAGACAGG
GAACAAAAGGCGCAGGCCCGCCAGCAGTTCGACGCCACACGCGGAATGCTGCGCGAGCTGGAGAGCGTCATCAGC
CTCCGGCCGCGGAGCCGACTCAGCGCACCGCCACTCGGCGGTAAACGGGTAACGTCCATGTGA
Transcript >Ophcf2|07284
ATGGAGCCCATCGTCTATCAGAAGACGCCTCTGGCCGACTATCTACGAGATGGAGGAGACGGATCCGACTCGGAA
TGGGCTGCTGGTGACAGCCCGCCTTCGCGAGCTCCCTCGTCCCCCTCGACGCTGCCTTCGCCGCCTTACAGTCCT
TCGCCTGTCGCTCCTTTTGCGCCATCCGGTCGTCCTCTTGTGAAGCGTCGCTTTCGAGCTCGTTCGCCGCCCGCC
TCACGTCCGGTCGAGCCACAGGTCGTGTCATTCCTGGGGGCCGTCAGGACCAGACTTTGGGCTGCCTTGACCGCC
TCCATTCACGACTCCGATCATGCCAAGTTTCTTGAACAGTTTCGATACACCATCATCGCCTCGCAGCTGCTGAGC
GGGCACTCCACCTCGAGTCACCGCTCCGGACCCGCCGTGCCGACGCTCGATGATCGAGACCAGCCGCTCCTCTCC
ACCGAGGGCGTCGTTGTGCCTGTACTGGGCGCTCTCGCCGTCGCCGCCTTCCTCAACTGGCTCCGCGGCAGTGGT
GCGCTTTCCACCATGAACCGCAAGCGTGTGGCTCTCGTCGTAGCCGCTCTCGCCCTCTCGGCTTTTCTGAGTCGC
GCCCACATGAGGAGACAGTGGCTGCGCTATCGTCGAGACCAGACCCTCTCTGAGATGACGGCCTTGGTCATCAAC
TCCCGGGACTTTGACAGCGCCACCGAAGCCACCCTGTCCTTGGTTCAAGAGGTGGAGCTGGTCTCGCGCGGTTAT
CGAATCAGCGCGCCTTTGCCTCCCATAAGCCGGCTGGAGGACCGGAGCCAGAATCGTAAATGCGTTCGCCTGCGC
AAGGTGCTCAAAGACTCTCTGAGCGACGCCCTCACCAAGTATACCCAGGCGTCCAGCGATGTCAAGGCCTTGTCC
GAGCAGACGGAGCTCGAAAAGTACTATGACCTGTACGACGTCGGAGACTTTGACATATCCGACGCCCTCCAGGGC
TTCTGCGAGACCGAATTCGAAGACCCAGAGTCGGTGCGGAGCCTCAAGATCCTGGCGGCCCGCTTCCTCACCACG
CGAAAGATGATACTCTGCGCGCTGCTGGCCCTAGACGCCAGCGATGAAGCGACGGAGCTCCTACGCTGGGGCGCC
GCTTACGAGGTGCTTCGGGGTCTCAACGCCACCATCAGGGCTGGCTACGAAGGGCTGAAGGCGACCTTGGCCGAC
GAAGCGGCTTTTCCCGTCCCGCCCTCTCCCAAGGAACCCCTGTCACCGGGCAGGGAGCGATGGCGGTCGCAGTGG
CGGAAGCTCGACTCGCTATCGACGGGTATCCGAGGCCTGCAGGCCAAACTTCATCTGCTGAGGGAGGAGTCGGAC
AGGGCCTTGGACGGCTCCGATGACATCTCGCGGCTGGGGCCGCACCTTTCGTCTCAGTACGAATCCATCGGCGTC
GACCTCCGGCAGCTCATGGCGGCGTGGGAAGAAGGCAAGGCTGCGCTGGCTCTCGGCATCGATAGGAACGAGAGG
AGGCTTTCGTCGAGGAGCTCCATGCTTTCGCCGACGGGATCGCTGAGCGGACTGACGACGGTGGACGAAGGCGGC
GACGCTTTGGACGCGCTCAAGGCACTGACGGGCGAGTCACCGCTACCGTCAGAGGCGGAGGCGGCCGAGGTGCTC
GAGGCGGTGGCCCGGCCCCGGCCCCGGAGCCTGCTGACGCGGGAAGAACGCATCGTCAAGATGAGGGAAGACAGG
GAACAAAAGGCGCAGGCCCGCCAGCAGTTCGACGCCACACGCGGAATGCTGCGCGAGCTGGAGAGCGTCATCAGC
CTCCGGCCGCGGAGCCGACTCAGCGCACCGCCACTCGGCGGTAAACGGGTAACGTCCATGTGA
Gene >Ophcf2|07284
ATGGAGCCCATCGTCTATCAGAAGACGCCTCTGGCCGACTATCTACGAGGTGTGTCTTCTCCGGCTCGTCTTGAT
CCTCCCTCATCGACTCATCCTTCTCGGGAACGTCCAGATGGAGGAGACGGATCCGACTCGGAATGGGCTGCTGGT
GACAGCCCGCCTTCGCGAGCTCCCTCGTCCCCCTCGACGCTGCCTTCGCCGCCTTACAGTCCTTCGCCTGTCGCT
CCTTTTGCGCCATCCGGTCGTCCTCTTGTGAAGCGTCGCTTTCGAGCTCGTTCGCCGCCCGCCTCACGTCCGGTC
GAGCCACAGGTCGTGTCATTCCTGGGGGCCGTCAGGACCAGACTTTGGGTGCGACTCTGTCTCGTTGTCCTGTCC
CTCCAAAAGCCAGGGTTAACTCTCCGACCACAGGCTGCCTTGACCGCCTCCATTCACGACTCCGATCATGCCAAG
TTTCTTGAACAGTTTCGATACACCATCATCGCCTCGCAGCTGCTGAGCGGGCACTCCACCTCGAGTCACCGCTCC
GGACCCGCCGTGCCGACGCTCGATGATCGAGACCAGCCGCTCCTCTCCACCGAGGGCGTCGTTGTGCCTGTACTG
GGCGCTCTCGCCGTCGCCGCCTTCCTCAACTGGCTCCGCGGCAGTGGTGCGCTTTCCACCATGAACCGCAAGCGT
GTGGCTCTCGTCGTAGCCGCTCTCGCCCTCTCGGCTTTTCTGAGTCGCGCCCACATGAGGAGACAGTGGCTGCGC
TATCGTCGAGACCAGACCCTCTCTGAGATGACGGCCTTGGTCATCAACTCCCGGGACTTTGACAGCGCCACCGAA
GCCACCCTGTCCTTGGTTCAAGAGGTGGAGCTGGTCTCGCGCGGTTATCGAATGTTGGTCTCGCCCAGGGTCTAG
TCGTGGACTGTCTCAATCGCTGACGCCTCCTGACAGCAGCGCGCCTTTGCCTCCCATAAGCCGGCTGGAGGACCG
GAGCCAGAATCGTAAATGCGTTCGCCTGCGCAAGGTGCTCAAAGACTCTCTGAGCGACGCCCTCACCAAGTATAC
CCAGGCGTCCAGCGATGTCAAGGCCTTGTCCGAGCAGACGGAGCTCGAAAAGTACTATGACCTGTACGACGTCGG
AGACTTTGACATATCCGACGCCCTCCAGGGCTTCTGCGAGACCGAATTCGAAGACCCAGAGTCGGTGCGGAGCCT
CAAGATCCTGGCGGCCCGCTTCCTCACCACGCGAAAGATGATACTCTGCGCGCTGCTGGCCCTAGACGCCAGCGA
TGAAGCGACGGAGCTCCTACGCTGGGGCGCCGCTTACGAGGTGCTTCGGGGTCTCAACGCCACCATCAGGGCTGG
CTACGAAGGGCTGAAGGCGACCTTGGCCGACGAAGCGGGTGAGAATTTCCCCATTTCACCCCTTGCCGCCGTCGA
CGCTGACCCGATTGGCCCTGTAGCTTTTCCCGTCCCGCCCTCTCCCAAGGAACCCCTGTCACCGGGCAGGGAGCG
ATGGCGGTCGCAGTGGCGGAAGCTCGACTCGCTATCGACGGGTATCCGAGGCCTGCAGGCCAAACTTCATCTGCT
GAGGGAGGAGTCGGACAGGGCCTTGGACGGCTCCGATGACATCTCGCGGCTGGGGCCGCACCTTTCGTCTCAGTA
CGAATCCATCGGCGTCGACCTCCGGCAGCTCATGGCGGCGTGGGAAGAAGGCAAGGCTGCGCTGGCTCTCGGCAT
CGATAGGAACGAGAGGAGGCTTTCGTCGAGGAGCTCCATGCTTTCGCCGACGGGATCGCTGAGCGGACTGACGAC
GGTGGACGAAGGCGGCGACGCTTTGGACGCGCTCAAGGCACTGACGGGCGAGTCACCGCTACCGTCAGAGGCGGA
GGCGGCCGAGGTGCTCGAGGCGGTGGCCCGGCCCCGGCCCCGGAGCCTGCTGACGCGGGAAGAACGCATCGTCAA
GATGAGGGAAGACAGGGAACAAAAGGCGCAGGCCCGCCAGCAGTTCGACGCCACACGCGGAATGCTGCGCGAGCT
GGAGAGCGTCATCAGCCTCCGGCCGCGGAGCCGACTCAGCGCACCGCCACTCGGCGGTAAACGGGTAACGTCCAT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail