Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07279
Gene name
Locationscaffold_09:1105100..1107743
Strand+
Gene length (bp)2643
Transcript length (bp)2643
Coding sequence length (bp)2643
Protein length (aa) 881

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2 2.3E-20 819 877
PF00888 Cullin Cullin family 7.2E-18 519 727

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0044237 cellular metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0009987 cellular process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0005488 binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0005515 protein binding No
GO:1901575 organic substance catabolic process No
GO:0008150 biological_process No
GO:0006508 proteolysis No
GO:0019941 modification-dependent protein catabolic process No
GO:0019899 enzyme binding No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5431 0.7112 0.1268 0.054 0.2315 0.0119 0.1393 0.3302 0.5681 0.0152

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6254
Ophiocordyceps australis map64 (Brazil) OphauB2|3162
Ophiocordyceps camponoti-floridani Ophcf2|07279 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6002
Ophiocordyceps kimflemingae Ophio5|2050
Ophiocordyceps subramaniannii Hirsu2|1430

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07279
MMMMTTTTTTTTTTTTMRARRAKVFHSVFQPDATPLLSGSRHFPFGDNEPSQVAAGSDQVRWERAWEVVTSRIRL
PTSVAAEDSFGTIPSESQVADDDLFGEALAIVLDPAGAVPRAVCTGDVLLWHSHQVREHFVHHVLPLLAACAARE
DASEVLLSSAQTLQAAHRQYSYGLTLVVGGIRQRHVREAAVAGFRRELHALVSSSWTTGLTAALRTVLTRLLSDV
LMVDVGGEPSKGRVEGASRALAELLSLLKSFQTMGLAGDSLHVLLAEIMDGRMSDFIDSAYAGVWAASTSCVDHL
RGWIDDHYGRVAAQVLACLGGRVSAEDVDRWREVAVGRLAALRTSELFDMVLDWPRSRGGLDDLRLAVTTPRRRL
QLTDAFSAALQKRLLHPGRSTLSILQTYIAMIRTFHALDASKVLLDRVAHALQLYLCQRDDAIRIVVTGLLANPK
AEADEEEEGGLDTRLVELAAILSDASQQRIGRSGGGGDDDLDWNDMGWVPDPVDAGVNYKRPKSEDVIGTLISAL
GSHDIFIKEFQLIVAERLLSRQTDFRQEVRVLALLKKRFGEAALQNCDVMIKDIYDSRRVDATICRNLAAARGLP
SYHSKILSRLFWPSLRREGFRVPGPVAAAKTRYEAGFEQLKTARKLGWLCHLGSATVRLELEDRSVDVECSTYEA
AVIYAFHDEGKGEGGHGQGPRRWRFDELWQHLTMDEDLLLLALNFWLSKRVLRDVGDQTYEVMESLGGQGSTTTE
AVTTATITTTTTTTTTTTTMTTTKNTATTPTTAVARGGQGQGDGPPLRKVKRLVDSAREKERRAVYWQFIVGMLT
NSSPAMPLGQISMMMKMLLTDGCPWSNEELQDFLGERVSSGELELVGGKYRLAKK*
Coding >Ophcf2|07279
ATGATGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATGCGGGCGCGAAGGGCCAAAGTCTTT
CACTCGGTATTCCAGCCTGATGCTACGCCCCTACTATCCGGCTCGCGACACTTTCCCTTCGGCGATAACGAGCCA
TCACAGGTAGCTGCCGGCAGCGATCAGGTCCGATGGGAGCGCGCCTGGGAGGTGGTGACGTCGCGCATCCGGCTG
CCGACGTCGGTGGCGGCCGAGGACTCGTTCGGCACGATCCCTTCCGAGTCGCAGGTGGCCGACGACGACTTATTC
GGCGAGGCGCTGGCCATCGTCCTGGACCCGGCTGGCGCGGTCCCGCGGGCCGTCTGCACGGGCGACGTCCTGCTG
TGGCACTCTCATCAGGTCCGGGAGCACTTCGTCCACCACGTCTTGCCGCTTCTGGCTGCCTGCGCCGCCCGCGAA
GACGCGTCCGAGGTTCTCCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCATCGGCAGTACTCGTACGGCCTGACG
CTCGTTGTTGGCGGCATCCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCAGGCGGGAGCTACACGCT
CTCGTCAGCAGTTCGTGGACGACGGGGCTGACGGCTGCGTTGCGGACGGTTCTTACGCGTTTGTTGTCTGATGTC
TTGATGGTTGATGTCGGTGGTGAGCCGAGCAAGGGTCGGGTCGAGGGCGCTTCTCGTGCGCTCGCTGAGCTGCTT
TCCCTGCTGAAGTCGTTCCAGACTATGGGCTTGGCCGGCGACTCCCTTCACGTACTGCTGGCTGAGATTATGGAC
GGCCGGATGAGCGACTTTATCGACAGTGCATACGCTGGCGTCTGGGCTGCGTCTACGTCGTGCGTTGATCACCTT
CGCGGCTGGATCGATGACCACTACGGCCGCGTCGCTGCTCAGGTGCTGGCTTGTCTCGGTGGCCGCGTCTCGGCC
GAGGATGTCGACCGCTGGAGGGAGGTGGCTGTCGGAAGGTTGGCGGCTCTGCGCACCAGCGAGCTATTCGACATG
GTGCTCGACTGGCCGAGGAGTCGGGGCGGGCTCGACGATCTACGCTTGGCCGTGACGACGCCCCGACGACGGCTG
CAGCTTACCGACGCCTTCTCGGCTGCGCTGCAGAAGCGGCTGCTTCACCCGGGCCGGTCGACCTTGTCGATCCTG
CAGACGTACATTGCCATGATTCGCACTTTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTAGCTCAC
GCGCTGCAGCTGTACCTGTGCCAGCGGGATGACGCCATCCGCATCGTCGTCACCGGCCTGCTGGCCAACCCCAAG
GCGGAGGCCGATGAGGAGGAGGAAGGGGGTCTTGACACCAGGCTCGTCGAGCTGGCCGCTATCCTCAGTGACGCC
TCGCAGCAGAGGATCGGCCGGAGTGGCGGCGGTGGCGACGATGACCTGGACTGGAACGACATGGGCTGGGTGCCG
GATCCCGTCGACGCCGGCGTCAACTACAAACGACCCAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTC
GGCTCGCATGACATCTTCATCAAGGAGTTTCAGCTCATCGTCGCTGAGCGGCTGCTGTCGCGGCAGACGGACTTT
CGACAGGAGGTCAGGGTACTGGCCCTGCTTAAGAAGCGATTCGGCGAGGCGGCCCTGCAAAACTGCGACGTCATG
ATCAAGGACATTTACGACTCGAGGCGCGTCGACGCCACCATCTGCAGGAACCTCGCGGCGGCGCGGGGACTGCCG
TCGTACCACTCCAAGATCCTGTCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTTCCGGGTCCG
GTGGCGGCGGCCAAGACACGGTACGAGGCCGGCTTCGAGCAGCTCAAGACGGCGAGGAAGCTGGGGTGGCTTTGT
CACCTTGGGTCTGCCACCGTCCGGCTCGAACTGGAGGATCGATCGGTGGATGTCGAGTGCAGCACGTACGAGGCT
GCCGTCATCTACGCCTTTCATGATGAAGGGAAGGGCGAGGGTGGGCATGGTCAGGGGCCGCGAAGGTGGAGGTTT
GATGAGCTGTGGCAGCATCTCACCATGGATGAGGATCTGCTGCTGTTGGCTCTCAACTTTTGGCTGTCTAAGCGG
GTTTTGCGAGACGTTGGGGATCAGACGTACGAGGTGATGGAGAGCCTTGGCGGTCAAGGGAGCACGACGACGGAG
GCGGTGACGACGGCTACGATTACGACGACGACGACGACGACGACGACGACGACGACGATGACGACGACGAAGAAC
ACGGCTACGACTCCGACGACGGCGGTGGCACGGGGTGGCCAAGGTCAAGGCGACGGGCCTCCGCTGCGGAAGGTG
AAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGCGGCGGGCCGTTTATTGGCAGTTCATCGTGGGAATGCTGACC
AATTCGAGCCCAGCAATGCCTCTGGGCCAGATATCGATGATGATGAAGATGCTCCTCACGGACGGGTGCCCCTGG
AGCAACGAAGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTAGCGGCGAGTTGGAGCTCGTGGGCGGCAAGTAT
CGGCTGGCCAAGAAATGA
Transcript >Ophcf2|07279
ATGATGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATGCGGGCGCGAAGGGCCAAAGTCTTT
CACTCGGTATTCCAGCCTGATGCTACGCCCCTACTATCCGGCTCGCGACACTTTCCCTTCGGCGATAACGAGCCA
TCACAGGTAGCTGCCGGCAGCGATCAGGTCCGATGGGAGCGCGCCTGGGAGGTGGTGACGTCGCGCATCCGGCTG
CCGACGTCGGTGGCGGCCGAGGACTCGTTCGGCACGATCCCTTCCGAGTCGCAGGTGGCCGACGACGACTTATTC
GGCGAGGCGCTGGCCATCGTCCTGGACCCGGCTGGCGCGGTCCCGCGGGCCGTCTGCACGGGCGACGTCCTGCTG
TGGCACTCTCATCAGGTCCGGGAGCACTTCGTCCACCACGTCTTGCCGCTTCTGGCTGCCTGCGCCGCCCGCGAA
GACGCGTCCGAGGTTCTCCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCATCGGCAGTACTCGTACGGCCTGACG
CTCGTTGTTGGCGGCATCCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCAGGCGGGAGCTACACGCT
CTCGTCAGCAGTTCGTGGACGACGGGGCTGACGGCTGCGTTGCGGACGGTTCTTACGCGTTTGTTGTCTGATGTC
TTGATGGTTGATGTCGGTGGTGAGCCGAGCAAGGGTCGGGTCGAGGGCGCTTCTCGTGCGCTCGCTGAGCTGCTT
TCCCTGCTGAAGTCGTTCCAGACTATGGGCTTGGCCGGCGACTCCCTTCACGTACTGCTGGCTGAGATTATGGAC
GGCCGGATGAGCGACTTTATCGACAGTGCATACGCTGGCGTCTGGGCTGCGTCTACGTCGTGCGTTGATCACCTT
CGCGGCTGGATCGATGACCACTACGGCCGCGTCGCTGCTCAGGTGCTGGCTTGTCTCGGTGGCCGCGTCTCGGCC
GAGGATGTCGACCGCTGGAGGGAGGTGGCTGTCGGAAGGTTGGCGGCTCTGCGCACCAGCGAGCTATTCGACATG
GTGCTCGACTGGCCGAGGAGTCGGGGCGGGCTCGACGATCTACGCTTGGCCGTGACGACGCCCCGACGACGGCTG
CAGCTTACCGACGCCTTCTCGGCTGCGCTGCAGAAGCGGCTGCTTCACCCGGGCCGGTCGACCTTGTCGATCCTG
CAGACGTACATTGCCATGATTCGCACTTTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTAGCTCAC
GCGCTGCAGCTGTACCTGTGCCAGCGGGATGACGCCATCCGCATCGTCGTCACCGGCCTGCTGGCCAACCCCAAG
GCGGAGGCCGATGAGGAGGAGGAAGGGGGTCTTGACACCAGGCTCGTCGAGCTGGCCGCTATCCTCAGTGACGCC
TCGCAGCAGAGGATCGGCCGGAGTGGCGGCGGTGGCGACGATGACCTGGACTGGAACGACATGGGCTGGGTGCCG
GATCCCGTCGACGCCGGCGTCAACTACAAACGACCCAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTC
GGCTCGCATGACATCTTCATCAAGGAGTTTCAGCTCATCGTCGCTGAGCGGCTGCTGTCGCGGCAGACGGACTTT
CGACAGGAGGTCAGGGTACTGGCCCTGCTTAAGAAGCGATTCGGCGAGGCGGCCCTGCAAAACTGCGACGTCATG
ATCAAGGACATTTACGACTCGAGGCGCGTCGACGCCACCATCTGCAGGAACCTCGCGGCGGCGCGGGGACTGCCG
TCGTACCACTCCAAGATCCTGTCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTTCCGGGTCCG
GTGGCGGCGGCCAAGACACGGTACGAGGCCGGCTTCGAGCAGCTCAAGACGGCGAGGAAGCTGGGGTGGCTTTGT
CACCTTGGGTCTGCCACCGTCCGGCTCGAACTGGAGGATCGATCGGTGGATGTCGAGTGCAGCACGTACGAGGCT
GCCGTCATCTACGCCTTTCATGATGAAGGGAAGGGCGAGGGTGGGCATGGTCAGGGGCCGCGAAGGTGGAGGTTT
GATGAGCTGTGGCAGCATCTCACCATGGATGAGGATCTGCTGCTGTTGGCTCTCAACTTTTGGCTGTCTAAGCGG
GTTTTGCGAGACGTTGGGGATCAGACGTACGAGGTGATGGAGAGCCTTGGCGGTCAAGGGAGCACGACGACGGAG
GCGGTGACGACGGCTACGATTACGACGACGACGACGACGACGACGACGACGACGACGATGACGACGACGAAGAAC
ACGGCTACGACTCCGACGACGGCGGTGGCACGGGGTGGCCAAGGTCAAGGCGACGGGCCTCCGCTGCGGAAGGTG
AAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGCGGCGGGCCGTTTATTGGCAGTTCATCGTGGGAATGCTGACC
AATTCGAGCCCAGCAATGCCTCTGGGCCAGATATCGATGATGATGAAGATGCTCCTCACGGACGGGTGCCCCTGG
AGCAACGAAGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTAGCGGCGAGTTGGAGCTCGTGGGCGGCAAGTAT
CGGCTGGCCAAGAAATGA
Gene >Ophcf2|07279
ATGATGATGATGACGACGACGACGACGACGACGACGACGACGACGACGATGCGGGCGCGAAGGGCCAAAGTCTTT
CACTCGGTATTCCAGCCTGATGCTACGCCCCTACTATCCGGCTCGCGACACTTTCCCTTCGGCGATAACGAGCCA
TCACAGGTAGCTGCCGGCAGCGATCAGGTCCGATGGGAGCGCGCCTGGGAGGTGGTGACGTCGCGCATCCGGCTG
CCGACGTCGGTGGCGGCCGAGGACTCGTTCGGCACGATCCCTTCCGAGTCGCAGGTGGCCGACGACGACTTATTC
GGCGAGGCGCTGGCCATCGTCCTGGACCCGGCTGGCGCGGTCCCGCGGGCCGTCTGCACGGGCGACGTCCTGCTG
TGGCACTCTCATCAGGTCCGGGAGCACTTCGTCCACCACGTCTTGCCGCTTCTGGCTGCCTGCGCCGCCCGCGAA
GACGCGTCCGAGGTTCTCCTCAGCAGCGCGCAGACTCTGCAGGCGGCTCATCGGCAGTACTCGTACGGCCTGACG
CTCGTTGTTGGCGGCATCCGCCAGCGTCATGTGCGGGAGGCGGCTGTGGCTGGCTTCAGGCGGGAGCTACACGCT
CTCGTCAGCAGTTCGTGGACGACGGGGCTGACGGCTGCGTTGCGGACGGTTCTTACGCGTTTGTTGTCTGATGTC
TTGATGGTTGATGTCGGTGGTGAGCCGAGCAAGGGTCGGGTCGAGGGCGCTTCTCGTGCGCTCGCTGAGCTGCTT
TCCCTGCTGAAGTCGTTCCAGACTATGGGCTTGGCCGGCGACTCCCTTCACGTACTGCTGGCTGAGATTATGGAC
GGCCGGATGAGCGACTTTATCGACAGTGCATACGCTGGCGTCTGGGCTGCGTCTACGTCGTGCGTTGATCACCTT
CGCGGCTGGATCGATGACCACTACGGCCGCGTCGCTGCTCAGGTGCTGGCTTGTCTCGGTGGCCGCGTCTCGGCC
GAGGATGTCGACCGCTGGAGGGAGGTGGCTGTCGGAAGGTTGGCGGCTCTGCGCACCAGCGAGCTATTCGACATG
GTGCTCGACTGGCCGAGGAGTCGGGGCGGGCTCGACGATCTACGCTTGGCCGTGACGACGCCCCGACGACGGCTG
CAGCTTACCGACGCCTTCTCGGCTGCGCTGCAGAAGCGGCTGCTTCACCCGGGCCGGTCGACCTTGTCGATCCTG
CAGACGTACATTGCCATGATTCGCACTTTTCACGCTCTCGACGCGTCCAAGGTGCTGCTGGATCGGGTAGCTCAC
GCGCTGCAGCTGTACCTGTGCCAGCGGGATGACGCCATCCGCATCGTCGTCACCGGCCTGCTGGCCAACCCCAAG
GCGGAGGCCGATGAGGAGGAGGAAGGGGGTCTTGACACCAGGCTCGTCGAGCTGGCCGCTATCCTCAGTGACGCC
TCGCAGCAGAGGATCGGCCGGAGTGGCGGCGGTGGCGACGATGACCTGGACTGGAACGACATGGGCTGGGTGCCG
GATCCCGTCGACGCCGGCGTCAACTACAAACGACCCAAGAGCGAGGACGTCATCGGCACCCTCATCAGCGCCCTC
GGCTCGCATGACATCTTCATCAAGGAGTTTCAGCTCATCGTCGCTGAGCGGCTGCTGTCGCGGCAGACGGACTTT
CGACAGGAGGTCAGGGTACTGGCCCTGCTTAAGAAGCGATTCGGCGAGGCGGCCCTGCAAAACTGCGACGTCATG
ATCAAGGACATTTACGACTCGAGGCGCGTCGACGCCACCATCTGCAGGAACCTCGCGGCGGCGCGGGGACTGCCG
TCGTACCACTCCAAGATCCTGTCTCGCCTCTTCTGGCCCAGCCTCCGAAGGGAGGGGTTCCGGGTTCCGGGTCCG
GTGGCGGCGGCCAAGACACGGTACGAGGCCGGCTTCGAGCAGCTCAAGACGGCGAGGAAGCTGGGGTGGCTTTGT
CACCTTGGGTCTGCCACCGTCCGGCTCGAACTGGAGGATCGATCGGTGGATGTCGAGTGCAGCACGTACGAGGCT
GCCGTCATCTACGCCTTTCATGATGAAGGGAAGGGCGAGGGTGGGCATGGTCAGGGGCCGCGAAGGTGGAGGTTT
GATGAGCTGTGGCAGCATCTCACCATGGATGAGGATCTGCTGCTGTTGGCTCTCAACTTTTGGCTGTCTAAGCGG
GTTTTGCGAGACGTTGGGGATCAGACGTACGAGGTGATGGAGAGCCTTGGCGGTCAAGGGAGCACGACGACGGAG
GCGGTGACGACGGCTACGATTACGACGACGACGACGACGACGACGACGACGACGACGATGACGACGACGAAGAAC
ACGGCTACGACTCCGACGACGGCGGTGGCACGGGGTGGCCAAGGTCAAGGCGACGGGCCTCCGCTGCGGAAGGTG
AAGCGGCTCGTCGACTCGGCGCGGGAAAAGGAGCGGCGGGCCGTTTATTGGCAGTTCATCGTGGGAATGCTGACC
AATTCGAGCCCAGCAATGCCTCTGGGCCAGATATCGATGATGATGAAGATGCTCCTCACGGACGGGTGCCCCTGG
AGCAACGAAGAGTTGCAGGACTTTCTGGGCGAGAGGGTTTCTAGCGGCGAGTTGGAGCTCGTGGGCGGCAAGTAT
CGGCTGGCCAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail