Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07276
Gene name
Locationscaffold_09:1094832..1095153
Strand-
Gene length (bp)321
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08636 Pkr1 ER protein Pkr1 6.1E-29 4 72

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 48 67 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 92.59 36.37 148.81
Alive In ants, during behavior modification 272.11 138.61 405.61
Dead In ants, recently dead 227.53 113.63 341.44

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.367960 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07276
MASSLATDLWDAIFTPGTTPALLRATNMSFACLQLVLGALLAATTSPHFVVLSGLCAVLWYSVNWFVAEMEAETR
KMSSSPSRGDESSDTEVEESVAGSRWAGVEA*
Coding >Ophcf2|07276
ATGGCGTCTTCGTTGGCAACGGATCTCTGGGACGCCATCTTCACGCCCGGAACGACACCTGCGCTCCTGCGCGCG
ACAAACATGTCCTTCGCCTGCCTGCAGCTCGTCCTAGGCGCGCTGCTAGCCGCGACGACGAGTCCGCACTTTGTC
GTGCTCTCGGGATTGTGCGCCGTGCTGTGGTATTCTGTCAACTGGTTCGTTGCCGAGATGGAGGCCGAGACGCGG
AAGATGTCGTCGTCTCCTTCCAGGGGGGACGAGAGTAGCGATACTGAGGTTGAGGAGTCGGTGGCGGGAAGTCGG
TGGGCGGGGGTTGAGGCTTAG
Transcript >Ophcf2|07276
ATGGCGTCTTCGTTGGCAACGGATCTCTGGGACGCCATCTTCACGCCCGGAACGACACCTGCGCTCCTGCGCGCG
ACAAACATGTCCTTCGCCTGCCTGCAGCTCGTCCTAGGCGCGCTGCTAGCCGCGACGACGAGTCCGCACTTTGTC
GTGCTCTCGGGATTGTGCGCCGTGCTGTGGTATTCTGTCAACTGGTTCGTTGCCGAGATGGAGGCCGAGACGCGG
AAGATGTCGTCGTCTCCTTCCAGGGGGGACGAGAGTAGCGATACTGAGGTTGAGGAGTCGGTGGCGGGAAGTCGG
TGGGCGGGGGTTGAGGCTTAG
Gene >Ophcf2|07276
ATGGCGTCTTCGTTGGCAACGGATCTCTGGGACGCCATCTTCACGCCCGGAACGACACCTGCGCTCCTGCGCGCG
ACAAACATGTCCTTCGCCTGCCTGCAGCTCGTCCTAGGCGCGCTGCTAGCCGCGACGACGAGTCCGCACTTTGTC
GTGCTCTCGGGATTGTGCGCCGTGCTGTGGTATTCTGTCAACTGGTTCGTTGCCGAGATGGAGGCCGAGACGCGG
AAGATGTCGTCGTCTCCTTCCAGGGGGGACGAGAGTAGCGATACTGAGGTTGAGGAGTCGGTGGCGGGAAGTCGG
TGGGCGGGGGTTGAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail