Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07275
Gene name
Locationscaffold_09:1092130..1094309
Strand+
Gene length (bp)2179
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 47 69 22
3 79 101 22
4 131 153 22
5 178 200 22
6 231 250 19
7 260 282 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07275
MARHVLVGEASVRGSSEAVQMMLLSFAAVGITIVWGVELTYCTPMAAIGHVIGYAAGSIDLVSLLGPSLGTAQFQ
QLTILAAISILASTSLTCCAVTERVLISSRKSRSATDLVRHIYRTIRHLRPRVQAICWAQFWAWIGWFPFLFYST
TWVGETYYRYDAGEKQPSEDGVGDMGRIGSLSLFIYSALTFIAAFVLPILVRSPEEERFTPRPWPVVARLLKAVG
DARPDLVTAWMYGHVVFAAAMVFAPLARSFRFATLLMCLCSLPWAMATWAPSALLGVEVNKMSGAYRPLAGDVEL
RPMDNPDQETDQEDEDNQDQPPLPNLEANPNPLPIPKP*
Coding >Ophcf2|07275
ATGGCGAGGCACGTGCTGGTGGGAGAAGCGTCGGTCAGGGGCAGCAGCGAGGCGGTGCAAATGATGCTGCTGTCC
TTTGCGGCCGTTGGCATCACCATCGTCTGGGGCGTGGAGCTGACGTATTGCACGCCAATGGCCGCCATCGGCCAC
GTCATCGGCTACGCTGCCGGCTCCATCGACCTCGTCTCCCTCCTCGGCCCCTCCCTCGGAACGGCCCAGTTCCAA
CAACTCACCATCCTGGCCGCCATCTCCATCCTCGCCTCCACGAGCCTCACCTGCTGCGCCGTAACAGAGCGCGTC
CTCATCTCCAGCCGCAAGTCCAGATCGGCCACCGACCTCGTCCGCCACATCTACCGCACCATCCGCCATCTCCGT
CCCCGCGTTCAGGCCATCTGTTGGGCCCAGTTCTGGGCTTGGATCGGGTGGTTCCCTTTTCTCTTTTACAGTACT
ACCTGGGTGGGCGAGACGTATTACCGCTACGATGCTGGCGAGAAGCAGCCTTCCGAGGACGGCGTCGGTGACATG
GGTCGTATAGGGAGTCTCTCCCTCTTCATATACTCGGCCCTCACCTTCATCGCCGCCTTTGTGCTCCCGATTCTG
GTCCGGTCACCGGAGGAGGAACGCTTCACGCCCCGTCCGTGGCCCGTCGTGGCTCGTCTTCTCAAAGCCGTGGGT
GATGCTCGTCCGGATCTGGTGACGGCTTGGATGTACGGACATGTCGTCTTTGCTGCTGCCATGGTGTTTGCGCCC
TTGGCTAGGAGCTTTCGTTTCGCTACCCTTCTCATGTGTCTCTGCTCGCTACCCTGGGCTATGGCTACCTGGGCG
CCTTCGGCTCTTCTAGGCGTCGAGGTTAACAAGATGAGCGGTGCATATCGTCCCTTGGCCGGAGACGTCGAGTTA
CGCCCAATGGACAACCCCGACCAAGAAACCGACCAAGAAGACGAAGACAACCAAGATCAACCACCACTCCCGAAC
CTAGAAGCCAACCCCAACCCCCTCCCCATCCCCAAGCCGTAA
Transcript >Ophcf2|07275
ATGGCGAGGCACGTGCTGGTGGGAGAAGCGTCGGTCAGGGGCAGCAGCGAGGCGGTGCAAATGATGCTGCTGTCC
TTTGCGGCCGTTGGCATCACCATCGTCTGGGGCGTGGAGCTGACGTATTGCACGCCAATGGCCGCCATCGGCCAC
GTCATCGGCTACGCTGCCGGCTCCATCGACCTCGTCTCCCTCCTCGGCCCCTCCCTCGGAACGGCCCAGTTCCAA
CAACTCACCATCCTGGCCGCCATCTCCATCCTCGCCTCCACGAGCCTCACCTGCTGCGCCGTAACAGAGCGCGTC
CTCATCTCCAGCCGCAAGTCCAGATCGGCCACCGACCTCGTCCGCCACATCTACCGCACCATCCGCCATCTCCGT
CCCCGCGTTCAGGCCATCTGTTGGGCCCAGTTCTGGGCTTGGATCGGGTGGTTCCCTTTTCTCTTTTACAGTACT
ACCTGGGTGGGCGAGACGTATTACCGCTACGATGCTGGCGAGAAGCAGCCTTCCGAGGACGGCGTCGGTGACATG
GGTCGTATAGGGAGTCTCTCCCTCTTCATATACTCGGCCCTCACCTTCATCGCCGCCTTTGTGCTCCCGATTCTG
GTCCGGTCACCGGAGGAGGAACGCTTCACGCCCCGTCCGTGGCCCGTCGTGGCTCGTCTTCTCAAAGCCGTGGGT
GATGCTCGTCCGGATCTGGTGACGGCTTGGATGTACGGACATGTCGTCTTTGCTGCTGCCATGGTGTTTGCGCCC
TTGGCTAGGAGCTTTCGTTTCGCTACCCTTCTCATGTGTCTCTGCTCGCTACCCTGGGCTATGGCTACCTGGGCG
CCTTCGGCTCTTCTAGGCGTCGAGGTTAACAAGATGAGCGGTGCATATCGTCCCTTGGCCGGAGACGTCGAGTTA
CGCCCAATGGACAACCCCGACCAAGAAACCGACCAAGAAGACGAAGACAACCAAGATCAACCACCACTCCCGAAC
CTAGAAGCCAACCCCAACCCCCTCCCCATCCCCAAGCCGTAA
Gene >Ophcf2|07275
ATGGCGAGGCACGTGCTGGTGGGAGAAGCGTCGGTCAGGGGCAGCAGCGAGGCGGTGCAAATGATGCTGCTGTCC
TTTGCGGCCGTTGGCATCACGTACGTGCCCCAATGGAAGTGTGTCCGGGGGGGGGGATCTATCTAACTGAAGAGC
AGCATCGTCTGGGGCGTGGAGCTGACGTGTTTGTCTACCCAATCATCAACGACAGCAAGAACAGACATCTAACCG
GCCTCTCTTCTGTGTGGAGAGGGGAAAAAACCCGTGAAGATTGCACGCCGTACCTCCTCGAGCTGGGTCTCAGCA
AGAGCCGAACATCTCTCATCTGGATCGCCGGCCCGTTATCGGGCCTGGTCGTGCAGCCCATCATCGGCGTCTTAT
CCGACGGGTGCACGAGCCGCTTCGGGAGGAGGAGGCCCTTTATGGTCGGGGGCGCCGTCGTCGTTGCCCTTGGGC
TTTTGGGCTTGGCGTTTGCGGCGAGGGTTGGGGGGGTTGGGGTTGCGATTGGGGGGATTTACGTGGTTGATTTTG
CGGTGAATGTTGGTGAGTACCTCTCTTGGTCTTTTCTTTCTTTCTTTTCTTATTGTTTTTTTTTTTTTGCCCTCG
GGATCCTCGTCTTTCGTTCTGGTCGAGGTTGCTGATTGATGGGGGTAGTTCAGGCTTGTGGGAGGAGTTTGGTTG
TTGATACGTTGGTTTTGGGGGAGCAGCAGAGGGGGGCTGCCTGGTGTGAGTATTTGTTTTCTTTTTTGGGGGGGG
GGGGGTTTGGATGATGCTTTCAGGGTTGTGTTTCTTTTTACATGAGGCTGCATCACGATACTCTCTCCTCACTAC
TCGTCATCACCATCCCTCACATCACGATACTCCCTCCCTCCTCACTACACTTCAACACCATCCCTCACATCACGA
TACTCTTTCTCTCACAACCCCAAGTGTCGACACTATACCTCTTACTCCCTCTCTCCTCACTACACTTCAACACCA
TCCCTCACATGACGATACTCCCTCTCTCCTCACTACTCGTCCTCACCATCCCTCACATCACGATACTCTCTCCCC
TCACAACACCAACTGTCAACACCATACCTTGTATCCAAACTCCCTCCTCTCACAACTCTCCCACACCATACCTCA
TACTTGCCTCCTCTCACAGCCCATCATACCCTCCCACAACCCTTCATCCCAGCTTCCTCCCACAACTCTACTAAC
TTATCCCCCCCTCCCCCCTCCCCCAGGGAGCAGAATGGCCGCCATCGGCCACGTCATCGGCTACGCTGCCGGCTC
CATCGACCTCGTCTCCCTCCTCGGCCCCTCCCTCGGAACGGCCCAGTTCCAACAACTCACCATCCTGGCCGCCAT
CTCCATCCTCGCCTCCACGAGCCTCACCTGCTGCGCCGTAACAGAGCGCGTCCTCATCTCCAGCCGCAAGTCCAG
ATCGGCCACCGACCTCGTCCGCCACATCTACCGCACCATCCGCCATCTCCGTCCCCGCGTTCAGGCCATCTGTTG
GGCCCAGTTCTGGGCTTGGATCGGGTGGTTCCCTTTTCTCTTTTACAGTACTACCTGGGTGGGCGAGACGTATTA
CCGCTACGATGCTGGCGAGAAGCAGCCTTCCGAGGACGGCGTCGGTGACATGGGTCGTATAGGGAGTCTCTCCCT
CTTCATATACTCGGCCCTCACCTTCATCGCCGCCTTTGTGCTCCCGATTCTGGTCCGGTCACCGGAGGAGGAACG
CTTCACGCCCCGTCCGTGGCCCGTCGTGGCTCGTCTTCTCAAAGCCGTGGGTGATGCTCGTCCGGATCTGGTGAC
GGCTTGGATGTACGGACATGTCGTCTTTGCTGCTGCCATGGTGTTTGCGCCCTTGGCTAGGAGCTTTCGTTTCGC
TACCCTTCTCATGTGTCTCTGCTCGCTGTGAGTTGGACACCTTCTATACCATTCCCCCTTTTCTCTTCCGGTCTG
ACTATGAATCAGACCCTGGGCTATGGCTACCTGGGCGCCTTCGGCTCTTCTAGGCGTCGAGGTTAACAAGATGAG
CGGTGCATATCGTCCCTTGGCCGGAGACGTCGAGTTACGCCCAATGGACAACCCCGACCAAGAAACCGACCAAGA
AGACGAAGACAACCAAGATCAACCACCACTCCCGAACCTAGAAGCCAACCCCAACCCCCTCCCCATCCCCAAGCC
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail