Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07272
Gene name
Locationscaffold_09:1078433..1080020
Strand+
Gene length (bp)1587
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 1.7E-14 320 408

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 77 96 19
3 100 122 22
4 233 255 22
5 275 297 22
6 369 391 22
7 401 423 22
8 436 454 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07272
MSIQLPFINTTGLSPSAPTLASVADQVRAACHDVLVHATGRGLPFLVPYTLMGTLIVPALWLAIPHLQRPLLYQT
RWLVVAACLAFNAHVTLSSGSDKLAISYSIGLVAAWGSMSVLHLLVWTRPQFDALRAVQVFDSPRVIDSKHGSGP
VGTFYWQPFPADAPFLVRLGWTVDLILSFRGIGWNWVIASVPRPRAPRANEPVDVDSMPLSSTSGSTRCLTEADF
VRKRLSSLAIQYIVLDACLIIITRDPYFLLGPDSDWELPFHLSGIPAWLLLVYRESIMGAIALCVLGVLFTINDL
VQYYYLKAYVSGRSALWLHPSSFGSFSSVLDRGLSGFWGGFWHQTFRQQFLAPANYLIDRGYLKRRSQAATNVMT
LISFFQSGVLHLAGSLSSIPETRIWRSMVFFLLQALGMFIQTTLSGHIRRRFSPSKALARTANLVFTTGWLYCTS
WLIMDDFISAGLAKTELLPVSPLRWAGFGRPTDSWLRWDRDCFPTWYRGQHWWESGIAL*
Coding >Ophcf2|07272
ATGTCTATTCAGCTCCCCTTCATAAACACCACGGGCTTATCCCCCTCAGCGCCTACCTTGGCCTCTGTGGCAGAC
CAGGTTCGAGCTGCCTGTCACGATGTACTCGTCCACGCCACGGGACGCGGCTTGCCCTTCCTGGTTCCTTATACT
CTTATGGGAACGCTCATCGTTCCGGCGCTGTGGCTTGCAATTCCGCATCTTCAGAGACCGCTTCTCTATCAGACG
AGATGGCTCGTTGTCGCCGCCTGTCTCGCCTTCAACGCACATGTTACTCTCAGCTCGGGCAGCGATAAACTGGCA
ATTTCATACTCCATCGGCCTCGTCGCAGCTTGGGGCTCAATGTCTGTTCTACACCTCCTCGTCTGGACACGACCT
CAGTTCGACGCCCTCAGGGCCGTCCAAGTCTTTGACAGTCCGAGGGTGATAGACTCCAAGCATGGATCTGGCCCC
GTCGGTACCTTTTACTGGCAGCCTTTTCCCGCTGACGCGCCATTCCTTGTCCGCCTCGGATGGACTGTCGATCTC
ATCCTCAGCTTCCGTGGCATCGGCTGGAACTGGGTCATAGCCTCCGTTCCTCGTCCCCGAGCTCCTCGCGCAAAC
GAGCCCGTCGACGTCGACTCCATGCCCTTATCCTCAACAAGCGGCTCTACGCGGTGTCTAACAGAAGCCGACTTT
GTTCGCAAGCGACTCTCCTCCTTGGCCATCCAGTATATCGTCCTCGACGCTTGCCTCATCATCATCACTCGCGAT
CCTTACTTCCTCCTCGGTCCCGACAGCGACTGGGAACTCCCCTTTCATCTAAGCGGCATCCCCGCCTGGCTTCTC
CTAGTCTATCGCGAGAGCATCATGGGCGCCATTGCTTTGTGCGTCCTCGGCGTCCTCTTCACCATCAATGATCTA
GTTCAGTACTACTATCTCAAGGCTTACGTTTCCGGCCGTTCCGCTCTGTGGCTTCACCCTTCTAGCTTTGGCAGC
TTTTCTTCCGTCCTAGACCGCGGCCTCTCCGGCTTCTGGGGCGGCTTCTGGCATCAAACGTTTCGCCAGCAGTTT
CTTGCGCCGGCCAACTATCTTATTGACAGGGGCTACCTGAAAAGGAGAAGCCAGGCTGCCACCAACGTCATGACC
CTCATCTCCTTCTTCCAGTCAGGTGTCTTACATCTCGCCGGCAGTCTCTCCAGCATCCCGGAAACGAGAATCTGG
CGATCCATGGTCTTCTTCCTCCTGCAGGCGCTAGGAATGTTCATTCAGACAACGCTGAGCGGACACATCAGACGT
CGCTTCTCGCCTTCAAAGGCTCTCGCCAGGACTGCCAACCTCGTCTTCACCACTGGCTGGCTGTACTGTACGTCC
TGGCTCATCATGGACGACTTCATCTCGGCCGGACTCGCCAAAACCGAGCTGCTCCCCGTTTCTCCCCTGCGCTGG
GCGGGCTTCGGTCGCCCGACGGATTCCTGGCTGCGTTGGGACCGTGACTGTTTTCCCACTTGGTATCGTGGACAG
CATTGGTGGGAGTCTGGGATTGCTCTGTAA
Transcript >Ophcf2|07272
ATGTCTATTCAGCTCCCCTTCATAAACACCACGGGCTTATCCCCCTCAGCGCCTACCTTGGCCTCTGTGGCAGAC
CAGGTTCGAGCTGCCTGTCACGATGTACTCGTCCACGCCACGGGACGCGGCTTGCCCTTCCTGGTTCCTTATACT
CTTATGGGAACGCTCATCGTTCCGGCGCTGTGGCTTGCAATTCCGCATCTTCAGAGACCGCTTCTCTATCAGACG
AGATGGCTCGTTGTCGCCGCCTGTCTCGCCTTCAACGCACATGTTACTCTCAGCTCGGGCAGCGATAAACTGGCA
ATTTCATACTCCATCGGCCTCGTCGCAGCTTGGGGCTCAATGTCTGTTCTACACCTCCTCGTCTGGACACGACCT
CAGTTCGACGCCCTCAGGGCCGTCCAAGTCTTTGACAGTCCGAGGGTGATAGACTCCAAGCATGGATCTGGCCCC
GTCGGTACCTTTTACTGGCAGCCTTTTCCCGCTGACGCGCCATTCCTTGTCCGCCTCGGATGGACTGTCGATCTC
ATCCTCAGCTTCCGTGGCATCGGCTGGAACTGGGTCATAGCCTCCGTTCCTCGTCCCCGAGCTCCTCGCGCAAAC
GAGCCCGTCGACGTCGACTCCATGCCCTTATCCTCAACAAGCGGCTCTACGCGGTGTCTAACAGAAGCCGACTTT
GTTCGCAAGCGACTCTCCTCCTTGGCCATCCAGTATATCGTCCTCGACGCTTGCCTCATCATCATCACTCGCGAT
CCTTACTTCCTCCTCGGTCCCGACAGCGACTGGGAACTCCCCTTTCATCTAAGCGGCATCCCCGCCTGGCTTCTC
CTAGTCTATCGCGAGAGCATCATGGGCGCCATTGCTTTGTGCGTCCTCGGCGTCCTCTTCACCATCAATGATCTA
GTTCAGTACTACTATCTCAAGGCTTACGTTTCCGGCCGTTCCGCTCTGTGGCTTCACCCTTCTAGCTTTGGCAGC
TTTTCTTCCGTCCTAGACCGCGGCCTCTCCGGCTTCTGGGGCGGCTTCTGGCATCAAACGTTTCGCCAGCAGTTT
CTTGCGCCGGCCAACTATCTTATTGACAGGGGCTACCTGAAAAGGAGAAGCCAGGCTGCCACCAACGTCATGACC
CTCATCTCCTTCTTCCAGTCAGGTGTCTTACATCTCGCCGGCAGTCTCTCCAGCATCCCGGAAACGAGAATCTGG
CGATCCATGGTCTTCTTCCTCCTGCAGGCGCTAGGAATGTTCATTCAGACAACGCTGAGCGGACACATCAGACGT
CGCTTCTCGCCTTCAAAGGCTCTCGCCAGGACTGCCAACCTCGTCTTCACCACTGGCTGGCTGTACTGTACGTCC
TGGCTCATCATGGACGACTTCATCTCGGCCGGACTCGCCAAAACCGAGCTGCTCCCCGTTTCTCCCCTGCGCTGG
GCGGGCTTCGGTCGCCCGACGGATTCCTGGCTGCGTTGGGACCGTGACTGTTTTCCCACTTGGTATCGTGGACAG
CATTGGTGGGAGTCTGGGATTGCTCTGTAA
Gene >Ophcf2|07272
ATGTCTATTCAGCTCCCCTTCATAAACACCACGGGCTTATCCCCCTCAGCGCCTACCTTGGCCTCTGTGGCAGAC
CAGGTTCGAGCTGCCTGTCACGATGTACTCGTCCACGCCACGGGACGCGGCTTGCCCTTCCTGGTTCCTTATACT
CTTATGGGAACGCTCATCGTTCCGGCGCTGTGGCTTGCAATTCCGCATCTTCAGAGACCGCTTCTCTATCAGACG
AGATGGCTCGTTGTCGCCGCCTGTCTCGCCTTCAACGCACATGTTACTCTCAGCTCGGGCAGCGATAAACTGGCA
ATTTCATACTCCATCGGCCTCGTCGCAGCTTGGGGCTCAATGTCTGTTCTACACCTCCTCGTCTGGACACGACCT
CAGTTCGACGCCCTCAGGGCCGTCCAAGTCTTTGACAGTCCGAGGGTGATAGACTCCAAGCATGGATCTGGCCCC
GTCGGTACCTTTTACTGGCAGCCTTTTCCCGCTGACGCGCCATTCCTTGTCCGCCTCGGATGGACTGTCGATCTC
ATCCTCAGCTTCCGTGGCATCGGTTCGTCGCAGTGATTTCCCCCATCTTTGATATGGCGCTGACCCCTTGAGCTT
CCAGGCTGGAACTGGGTCATAGCCTCCGTTCCTCGTCCCCGAGCTCCTCGCGCAAACGAGCCCGTCGACGTCGAC
TCCATGCCCTTATCCTCAACAAGCGGCTCTACGCGGTGTCTAACAGAAGCCGACTTTGTTCGCAAGCGACTCTCC
TCCTTGGCCATCCAGTATATCGTCCTCGACGCTTGCCTCATCATCATCACTCGCGATCCTTACTTCCTCCTCGGT
CCCGACAGCGACTGGGAACTCCCCTTTCATCTAAGCGGCATCCCCGCCTGGCTTCTCCTAGTCTATCGCGAGAGC
ATCATGGGCGCCATTGCTTTGTGCGTCCTCGGCGTCCTCTTCACCATCAATGATCTAGTTCAGTACTACTATCTC
AAGGCTTACGTTTCCGGCCGTTCCGCTCTGTGGCTTCACCCTTCTAGCTTTGGCAGCTTTTCTTCCGTCCTAGAC
CGCGGCCTCTCCGGCTTCTGGGGCGGCTTCTGGCATCAAACGTTTCGCCAGCAGTTTCTTGCGCCGGCCAACTAT
CTTATTGACAGGGGCTACCTGAAAAGGAGAAGCCAGGCTGCCACCAACGTCATGACCCTCATCTCCTTCTTCCAG
TCAGGTGTCTTACATCTCGCCGGCAGTCTCTCCAGCATCCCGGAAACGAGAATCTGGCGATCCATGGTCTTCTTC
CTCCTGCAGGCGCTAGGAATGTTCATTCAGACAACGCTGAGCGGACACATCAGACGTCGCTTCTCGCCTTCAAAG
GCTCTCGCCAGGACTGCCAACCTCGTCTTCACCACTGGCTGGCTGTACTGTACGTCCTGGCTCATCATGGACGAC
TTCATCTCGGCCGGACTCGCCAAAACCGAGCTGCTCCCCGTTTCTCCCCTGCGCTGGGCGGGCTTCGGTCGCCCG
ACGGATTCCTGGCTGCGTTGGGACCGTGACTGTTTTCCCACTTGGTATCGTGGACAGCATTGGTGGGAGTCTGGG
ATTGCTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail