Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07269
Gene name
Locationscaffold_09:1070274..1073644
Strand+
Gene length (bp)3370
Transcript length (bp)2691
Coding sequence length (bp)2691
Protein length (aa) 897

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 2.9E-29 568 663
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 1.2E-25 694 874
PF07808 RED_N RED-like protein N-terminal region 1.5E-07 86 211

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5133 0.5778 0.1168 0.0185 0.1868 0.07 0.2806 0.0863 0.0848 0.0725

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|219
Ophiocordyceps australis map64 (Brazil) OphauB2|508
Ophiocordyceps camponoti-floridani Ophcf2|07269 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3055
Ophiocordyceps kimflemingae Ophio5|1895
Ophiocordyceps subramaniannii Hirsu2|10700

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07269
MHRRERKMNNEEFRKLVLENAGQIKKDAPSATKDRRSATGSLGSRERSSIPMTPRSALSAQAVFAKQVAERNEAV
RARKKFKTSAPKGVKLASGYVDRAKERQDEPTDDRGERLSALEKAFQAGKIEKAAYDKLRFDIAGGSLDSTHLVK
GLDFKLLERVRRGEDVYGKKTSNADEEAVEDEGDDVDDALEEIEHSQVKATEKDKTVKKKGQLATAPVAGQKRTR
DQILAELKASREAAKTQKESSLGSKFKRIGSKQKPGTRIERDGKGREILIIVDEDGREKRKVRKLQSEEAENEAG
SGLLMPDPDAEPLGMEVPEKYSPRAESEVDLDGDIFEGVGDDYDPLADLEASDSGSDSDADSAADADEAHAEKKG
KATDKETMPPPRETPTARPNYFAGSKTSLLSEETSQAPSATDPALLAAIKRAAKLRRIEDEADKESRESMEERRR
KLELMKARDDDDLDMGFGTSRFEDEEDGEEEEGPKKRKGDGNSVADVMRVVEQRKQSASPHNLNRPDHPPHLPSP
SPSPVSSHPTPAKQQPTIANATSSKRHRQPPPPPFQLSNEDSLWLDCDPGHDDAFAMLLAAHHPSFNLLGISTVF
GNASLERTTRNAASLLTALSKSHIPLHAGSSKALTRPALHAPTEIHGESGLDGTKLLPAPHAHPPPPRPSKPWPK
LSRRKPPAPHGSVVQGVPRIGNASPHAEFNILLDPEAAALIFHNEDIAAKTTVVPLDLSHQVLATEQVRSLLLYG
ADGLPDGDGKTTLRTMLVELLYFFAKTYSDVFGFTAGPPLHDPIAVAAVLIGTTDEIPFSEWDASRSESPRHDER
FQVTVITDGTFDEAKSGEKQTGRTFARALPPGQPGVRIPRSMDVARFWQVIEECIQRADVANGADQTGESA*
Coding >Ophcf2|07269
ATGCATCGCCGAGAAAGAAAGATGAACAACGAGGAGTTCCGCAAGCTGGTGCTCGAAAACGCGGGACAAATAAAG
AAAGATGCTCCCTCTGCTACGAAAGATCGTCGGAGCGCCACCGGATCTCTGGGCTCGCGAGAACGAAGCAGCATT
CCGATGACGCCTCGATCAGCTCTCAGCGCTCAAGCTGTGTTTGCAAAACAGGTCGCCGAGAGAAACGAAGCCGTC
CGCGCGAGGAAGAAATTCAAGACGTCTGCGCCCAAGGGCGTAAAGCTGGCCTCGGGCTACGTCGATCGCGCAAAG
GAACGACAGGATGAGCCGACCGACGACAGAGGCGAGAGATTGTCTGCGCTGGAGAAAGCCTTTCAAGCTGGGAAA
ATCGAAAAGGCTGCTTATGACAAGCTGAGGTTTGACATTGCCGGTGGCTCTCTTGACAGCACTCATCTGGTCAAA
GGTCTCGACTTTAAGCTGCTGGAGAGGGTGCGTCGAGGGGAGGATGTTTACGGAAAGAAGACGAGCAACGCCGAC
GAGGAAGCCGTTGAAGATGAAGGCGATGACGTCGACGACGCATTGGAGGAGATTGAGCACAGTCAGGTGAAAGCG
ACAGAAAAGGACAAGACGGTCAAGAAGAAGGGACAATTGGCCACAGCTCCCGTCGCTGGCCAGAAACGAACACGA
GATCAGATTCTGGCGGAGCTAAAAGCATCAAGAGAGGCTGCAAAAACACAGAAGGAGTCGTCGCTGGGAAGCAAG
TTCAAAAGAATAGGAAGCAAGCAGAAGCCAGGAACGCGAATCGAGCGGGACGGCAAGGGAAGAGAAATTCTCATC
ATCGTTGACGAAGACGGCCGCGAGAAGCGAAAAGTGCGCAAGCTGCAGTCTGAAGAGGCAGAGAACGAGGCAGGC
AGCGGTCTCCTGATGCCGGATCCCGATGCCGAGCCGCTGGGAATGGAGGTGCCCGAAAAGTACAGTCCGAGGGCG
GAGTCCGAGGTGGACTTGGACGGCGACATATTCGAGGGCGTCGGGGACGATTACGATCCCCTCGCCGACTTGGAG
GCTTCAGACTCTGGCTCTGACTCGGACGCCGACTCTGCCGCGGATGCAGACGAGGCCCATGCCGAGAAAAAGGGC
AAAGCAACGGACAAGGAGACGATGCCTCCACCACGAGAAACCCCAACGGCACGCCCCAACTACTTCGCCGGCTCC
AAAACGAGCCTCCTCTCGGAAGAAACAAGCCAAGCCCCATCCGCCACCGACCCAGCCCTCCTAGCAGCCATCAAA
CGCGCCGCGAAACTCCGCCGCATCGAGGACGAAGCCGACAAGGAAAGCCGCGAAAGCATGGAAGAACGGCGTCGC
AAGTTGGAGCTGATGAAGGCTCGGGACGACGATGACCTTGATATGGGCTTCGGCACGAGCAGATTCGAGGACGAG
GAGGATGGCGAAGAGGAAGAGGGGCCTAAGAAGCGGAAGGGTGATGGGAATAGCGTTGCTGATGTGATGCGTGTG
GTTGAGCAGCGGAAACAGTCAGCCTCACCCCACAATCTCAACCGGCCCGACCATCCGCCTCACCTGCCCTCACCT
TCACCTTCACCCGTCAGCTCTCACCCAACACCAGCAAAGCAGCAACCTACCATCGCCAACGCCACATCCTCAAAA
CGCCACAGACAACCCCCCCCCCCCCCCTTTCAACTTAGCAATGAAGATTCCCTCTGGCTGGACTGCGATCCAGGT
CACGATGATGCATTCGCGATGCTCCTCGCAGCGCATCATCCATCTTTCAACCTCCTGGGCATATCAACCGTCTTC
GGCAACGCCTCGCTAGAACGCACAACCCGAAACGCAGCCTCCCTCCTAACCGCCCTCTCAAAATCCCACATCCCC
CTCCACGCAGGCTCCTCCAAAGCCCTCACCCGCCCAGCCCTCCACGCGCCCACCGAAATCCACGGCGAAAGCGGC
CTCGACGGCACGAAGCTCCTCCCCGCCCCTCATGCACACCCTCCACCACCCCGGCCGTCGAAGCCATGGCCGAAG
CTCTCTCGGCGCAAACCCCCGGCACCGCATGGATCTGTTGTTCAGGGCGTGCCTCGCATAGGCAATGCGTCGCCG
CATGCAGAGTTTAATATCCTTCTCGATCCAGAGGCAGCAGCACTCATATTTCACAATGAGGATATTGCTGCCAAG
ACGACTGTCGTGCCGCTGGATTTGAGCCATCAGGTGCTGGCAACCGAACAAGTCAGGAGTCTCCTCCTCTACGGC
GCCGACGGCCTACCCGATGGCGACGGCAAGACGACGCTTCGAACCATGCTGGTTGAATTATTATATTTCTTCGCA
AAGACATATTCAGACGTCTTTGGATTCACCGCCGGCCCGCCGCTGCACGATCCCATCGCCGTGGCCGCCGTGCTA
ATCGGCACGACAGATGAGATTCCCTTTTCCGAATGGGACGCGTCCAGAAGCGAGTCGCCGCGGCATGATGAGCGC
TTCCAAGTCACCGTCATCACCGACGGCACCTTTGACGAGGCCAAGAGCGGCGAGAAGCAGACGGGCAGGACATTT
GCGCGGGCCTTGCCTCCCGGACAACCGGGCGTGCGCATCCCCCGAAGCATGGACGTGGCCAGGTTCTGGCAAGTC
ATAGAGGAGTGCATTCAGCGAGCCGATGTTGCCAACGGGGCGGATCAGACAGGGGAAAGCGCTTGA
Transcript >Ophcf2|07269
ATGCATCGCCGAGAAAGAAAGATGAACAACGAGGAGTTCCGCAAGCTGGTGCTCGAAAACGCGGGACAAATAAAG
AAAGATGCTCCCTCTGCTACGAAAGATCGTCGGAGCGCCACCGGATCTCTGGGCTCGCGAGAACGAAGCAGCATT
CCGATGACGCCTCGATCAGCTCTCAGCGCTCAAGCTGTGTTTGCAAAACAGGTCGCCGAGAGAAACGAAGCCGTC
CGCGCGAGGAAGAAATTCAAGACGTCTGCGCCCAAGGGCGTAAAGCTGGCCTCGGGCTACGTCGATCGCGCAAAG
GAACGACAGGATGAGCCGACCGACGACAGAGGCGAGAGATTGTCTGCGCTGGAGAAAGCCTTTCAAGCTGGGAAA
ATCGAAAAGGCTGCTTATGACAAGCTGAGGTTTGACATTGCCGGTGGCTCTCTTGACAGCACTCATCTGGTCAAA
GGTCTCGACTTTAAGCTGCTGGAGAGGGTGCGTCGAGGGGAGGATGTTTACGGAAAGAAGACGAGCAACGCCGAC
GAGGAAGCCGTTGAAGATGAAGGCGATGACGTCGACGACGCATTGGAGGAGATTGAGCACAGTCAGGTGAAAGCG
ACAGAAAAGGACAAGACGGTCAAGAAGAAGGGACAATTGGCCACAGCTCCCGTCGCTGGCCAGAAACGAACACGA
GATCAGATTCTGGCGGAGCTAAAAGCATCAAGAGAGGCTGCAAAAACACAGAAGGAGTCGTCGCTGGGAAGCAAG
TTCAAAAGAATAGGAAGCAAGCAGAAGCCAGGAACGCGAATCGAGCGGGACGGCAAGGGAAGAGAAATTCTCATC
ATCGTTGACGAAGACGGCCGCGAGAAGCGAAAAGTGCGCAAGCTGCAGTCTGAAGAGGCAGAGAACGAGGCAGGC
AGCGGTCTCCTGATGCCGGATCCCGATGCCGAGCCGCTGGGAATGGAGGTGCCCGAAAAGTACAGTCCGAGGGCG
GAGTCCGAGGTGGACTTGGACGGCGACATATTCGAGGGCGTCGGGGACGATTACGATCCCCTCGCCGACTTGGAG
GCTTCAGACTCTGGCTCTGACTCGGACGCCGACTCTGCCGCGGATGCAGACGAGGCCCATGCCGAGAAAAAGGGC
AAAGCAACGGACAAGGAGACGATGCCTCCACCACGAGAAACCCCAACGGCACGCCCCAACTACTTCGCCGGCTCC
AAAACGAGCCTCCTCTCGGAAGAAACAAGCCAAGCCCCATCCGCCACCGACCCAGCCCTCCTAGCAGCCATCAAA
CGCGCCGCGAAACTCCGCCGCATCGAGGACGAAGCCGACAAGGAAAGCCGCGAAAGCATGGAAGAACGGCGTCGC
AAGTTGGAGCTGATGAAGGCTCGGGACGACGATGACCTTGATATGGGCTTCGGCACGAGCAGATTCGAGGACGAG
GAGGATGGCGAAGAGGAAGAGGGGCCTAAGAAGCGGAAGGGTGATGGGAATAGCGTTGCTGATGTGATGCGTGTG
GTTGAGCAGCGGAAACAGTCAGCCTCACCCCACAATCTCAACCGGCCCGACCATCCGCCTCACCTGCCCTCACCT
TCACCTTCACCCGTCAGCTCTCACCCAACACCAGCAAAGCAGCAACCTACCATCGCCAACGCCACATCCTCAAAA
CGCCACAGACAACCCCCCCCCCCCCCCTTTCAACTTAGCAATGAAGATTCCCTCTGGCTGGACTGCGATCCAGGT
CACGATGATGCATTCGCGATGCTCCTCGCAGCGCATCATCCATCTTTCAACCTCCTGGGCATATCAACCGTCTTC
GGCAACGCCTCGCTAGAACGCACAACCCGAAACGCAGCCTCCCTCCTAACCGCCCTCTCAAAATCCCACATCCCC
CTCCACGCAGGCTCCTCCAAAGCCCTCACCCGCCCAGCCCTCCACGCGCCCACCGAAATCCACGGCGAAAGCGGC
CTCGACGGCACGAAGCTCCTCCCCGCCCCTCATGCACACCCTCCACCACCCCGGCCGTCGAAGCCATGGCCGAAG
CTCTCTCGGCGCAAACCCCCGGCACCGCATGGATCTGTTGTTCAGGGCGTGCCTCGCATAGGCAATGCGTCGCCG
CATGCAGAGTTTAATATCCTTCTCGATCCAGAGGCAGCAGCACTCATATTTCACAATGAGGATATTGCTGCCAAG
ACGACTGTCGTGCCGCTGGATTTGAGCCATCAGGTGCTGGCAACCGAACAAGTCAGGAGTCTCCTCCTCTACGGC
GCCGACGGCCTACCCGATGGCGACGGCAAGACGACGCTTCGAACCATGCTGGTTGAATTATTATATTTCTTCGCA
AAGACATATTCAGACGTCTTTGGATTCACCGCCGGCCCGCCGCTGCACGATCCCATCGCCGTGGCCGCCGTGCTA
ATCGGCACGACAGATGAGATTCCCTTTTCCGAATGGGACGCGTCCAGAAGCGAGTCGCCGCGGCATGATGAGCGC
TTCCAAGTCACCGTCATCACCGACGGCACCTTTGACGAGGCCAAGAGCGGCGAGAAGCAGACGGGCAGGACATTT
GCGCGGGCCTTGCCTCCCGGACAACCGGGCGTGCGCATCCCCCGAAGCATGGACGTGGCCAGGTTCTGGCAAGTC
ATAGAGGAGTGCATTCAGCGAGCCGATGTTGCCAACGGGGCGGATCAGACAGGGGAAAGCGCTTGA
Gene >Ophcf2|07269
ATGCATCGCCGAGAAAGAAAGATGAACAACGAGGAGTTCCGCAAGCTGGTGCTCGAAAACGCGGGACAAATAAAG
AAAGATGCTCCCTCTGCTACGAAAGATCGTCGGAGCGCCACCGGATCTCTGGGCTCGCGAGAACGAAGCAGCATT
CCGATGACGCCGTGAGTCGACGCCTTTCCATTGCGCAGACGCTTTGCTGACGCGCTATGCAGTCGATCAGCTCTC
AGCGCTCAAGCTGTGTTTGCAAAACAGGTCGCCGAGAGAAACGAAGCCGTCCGCGCGAGGAAGAAATTCAAGACG
TCTGCGCCCAAGGGCGTAAAGCTGGCCTCGGGCTACGTCGATCGCGCAAAGGAACGACAGGATGAGCCGACCGAC
GACAGAGGCGAGAGATTGTCTGCGCTGGAGAAAGCCTTTCAAGCTGGGAAAATCGAAAAGGCTGCTTATGACAAG
CTGAGGTTTGACATTGCCGGTGGCTCTCTTGACAGCACTCATCTGGTCAAAGGTCTCGACTTTAAGCTGCTGGAG
AGGGTGCGTCGAGGGGAGGATGTTTACGGAAAGAAGACGAGCAACGCCGACGAGGAAGCCGTTGAAGATGAAGGC
GATGACGTCGACGACGCATTGGAGGAGATTGAGCACAGTCAGGTGAAAGCGACAGAAAAGGACAAGACGGTCAAG
AAGAAGGGACAATTGGCCACAGCTCCCGTCGCTGGCCAGAAACGAACACGAGATCAGATTCTGGCGGAGCTAAAA
GCATCAAGAGAGGCTGCAAAAACACAGAAGGAGTCGTCGCTGGGAAGCAAGTTCAAAAGAATAGGAAGCAAGCAG
AAGCCAGGAACGCGAATCGAGCGGGACGGCAAGGGAAGAGAAATTCTCATCATCGTTGACGAAGACGGCCGCGAG
AAGCGAAAAGTGCGCAAGCTGCAGTCTGAAGAGGCAGAGAACGAGGCAGGCAGCGGTCTCCTGATGCCGGATCCC
GATGCCGAGCCGCTGGGAATGGAGGTGCCCGAAAAGTACAGTCCGAGGGCGGAGTCCGAGGTGGACTTGGACGGC
GACATATTCGAGGGCGTCGGGGACGATTACGATCCCCTCGCCGACTTGGAGGCTTCAGACTCTGGCTCTGACTCG
GACGCCGACTCTGCCGCGGATGCAGACGAGGCCCATGCCGAGAAAAAGGGCAAAGCAACGGACAAGGAGACGATG
CCTCCACCACGAGAAACCCCAACGGCACGCCCCAACTACTTCGCCGGCTCCAAAACGAGCCTCCTCTCGGAAGAA
ACAAGCCAAGCCCCATCCGCCACCGACCCAGCCCTCCTAGCAGCCATCAAACGCGCCGCGAAACTCCGCCGCATC
GAGGACGAAGCCGACAAGGAAAGCCGCGAAAGCATGGAAGAACGGCGTCGCAAGTTGGAGCTGATGAAGGCTCGG
GACGACGATGACCTTGATATGGGCTTCGGCACGAGCAGATTCGAGGACGAGGAGGATGGTGAGGGGGGGGTCAGC
TTATCTGTTTGGGATGGTGAGGGCGAGGGTGAGGGCGAGGCTAGGGGAGGGGAGGGCAGGCGAAGAGGAAGAGGG
GCCTAAGAAGCGGAAGGGTGATGGGAATAGCGTTGCTGATGTGATGCGTGTGGTTGAGCAGCGGAAACAGTCGTG
AGTGATGGACAGCTGCTGAGTGGTCTAGCAGAATCTGTCATCTGTCTTATATTAGCGGTATGGAAAATTAGAAAC
AACGGATATCAGACTCTTTAAGGGCCGGGCTCTTCATGACTACCTCTCCGCATCTATCCGTACAACGTGCATACC
TATCCACAGCCCCATCCCCCCACATCTTCACCAAACGCACGTGCGCCCGTTAAGACCCACCAGAGCCTCACCCCA
CAATCTCAACCGGCCCGACCATCCGCCTCACCTGCCCTCACCTTCACCTTCACCCGTCAGCTCTCACCCAACACC
AGCAAAGCAGCAACCTACCATCGCCAACGCCACATCCTCAAAACGCCACAGACAACCCCCCCCCCCCCCCTTTCA
ACTTAGCAATGAAGATTCCCTCTGGCTGGACTGCGATCCAGGTCACGATGCGAGTTACCCCATTTCCCCCTCCCC
CTCTCCCGCGCGTGATGCCCGCCATGCAGGCGACTACTAACAGACACAGGATGCATTCGCGATGCTCCTCGCAGC
GCATCATCCATCTTTCAACCTCCTGGGCATATCAACCGTCTTCGGCAACGCCTCGCTAGAGTACGTACATACACG
TCAACCTACATACATACATACACACATCAGACTCTCAAGATAGCAACCAGACGCACAACCCGAAACGCAGCCTCC
CTCCTAACCGCCCTCTCAAAATCCCACATCCCCCTCCACGCAGGCTCCTCCAAAGCCCTCACCCGCCCAGCCCTC
CACGCGCCCACCGAAATCCACGGCGAAAGCGGCCTCGACGGCACGAAGCTCCTCCCCGCCCCTCATGCACACCCT
CCACCACCCCGGCCGTCGAAGCCATGGCCGAAGCTCTCTCGGCGCAAACCCCCGGCACCGCATGGATCGTGGCGA
CGGGCGCGCTGACAAACGTCGCCGCTTTGTTTACCAGGTTTCCGCATCTGGTTGCTCGTGTCAAGGGTTTGAGTC
TCATGGGCGGGTCGTTTGGGGGGGTTTCTCGGATGTGCCCGTCAGTGTTGTTCAGGGCGTGCCTCGCATAGGCAA
TGCGTCGCCGCATGCAGAGTTTAATATCCTTCTCGATCCAGAGGCAGCAGCACTCATATTTCACAATGAGGATAT
TGCTGCCAAGACGACTGTCGTGCCGCTGGATTTGAGCCATCAGGTGCTGGCAACCGAACAAGTCAGGAGTCTCCT
CCTCTACGGCGCCGACGGCCTACCCGATGGCGACGGCAAGACGACGCTTCGAACCATGCTGGTTGAATTATTATA
TTTCTTCGCAAAGACATATTCGTACGTTTTTGCCCTTGCGTTGCCCATCCGATCAATATCACCAGCCTGCTAACA
GCTCGCCCTCCCCAGAGACGTCTTTGGATTCACCGCCGGCCCGCCGCTGCACGATCCCATCGCCGTGGCCGCCGT
GCTAATCGGCACGACAGATGAGATTCCCTTTTCCGAATGGGACGCGTCCAGAAGCGAGTCGCCGCGGCATGATGA
GCGCTTCCAAGTCACCGTCATCACCGACGGCACCTTTGACGAGGCCAAGAGCGGCGAGAAGCAGACGGGCAGGAC
ATTTGCGCGGGCCTTGCCTCCCGGACAACCGGGCGTGCGCATCCCCCGAAGCATGGACGTGGCCAGGTTCTGGCA
AGTCATAGAGGAGTGCATTCAGCGAGCCGATGTTGCCAACGGGGCGGATCAGACAGGGGAAAGCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail