Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07265
Gene name
Locationscaffold_09:1061106..1061850
Strand+
Gene length (bp)744
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03073 TspO_MBR TspO/MBR family 1.5E-45 22 173

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 64 86 22
3 99 118 19
4 123 145 22
5 152 174 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07265
MTTYMSSITIPAAVLQHPAASVLLPVALGTAVGFGTRPSETKKTYLALKQPPLRPPPWAFGPVWTLLYGIMGYAS
YRVATIGLGPFASPETVRVTRQSLTLYTVQLGLNLAWMPLFFVAKRPVEATIDIVTLLGLNGYLAYLWHSVDHVA
GLCQVPYIGWLSFATYLCAGAGYLNDWDLSDKTARVADKEK*
Coding >Ophcf2|07265
ATGACAACCTACATGTCAAGCATCACCATCCCGGCCGCCGTGCTCCAGCACCCGGCCGCCTCGGTTCTTCTCCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACTCGCCCTTCTGAGACGAAAAAGACATACCTCGCTCTTAAGCAG
CCGCCGCTGCGACCTCCGCCTTGGGCCTTTGGTCCCGTCTGGACGTTGCTCTACGGGATCATGGGCTACGCTTCG
TATCGTGTCGCCACCATCGGCCTCGGGCCCTTTGCCTCCCCCGAGACCGTCCGCGTCACCAGGCAAAGCTTAACG
CTATACACTGTCCAACTCGGCCTCAACCTCGCATGGATGCCCCTCTTCTTCGTCGCCAAGCGTCCCGTAGAGGCC
ACCATCGACATCGTCACCCTGCTCGGCCTCAATGGCTACCTGGCCTACCTGTGGCATTCGGTCGACCACGTAGCC
GGCCTGTGTCAGGTGCCTTATATCGGCTGGCTGAGCTTTGCCACCTATCTGTGCGCTGGCGCCGGATACCTCAAC
GACTGGGACCTTTCAGACAAGACGGCTCGCGTGGCTGACAAGGAGAAGTAG
Transcript >Ophcf2|07265
ATGACAACCTACATGTCAAGCATCACCATCCCGGCCGCCGTGCTCCAGCACCCGGCCGCCTCGGTTCTTCTCCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACTCGCCCTTCTGAGACGAAAAAGACATACCTCGCTCTTAAGCAG
CCGCCGCTGCGACCTCCGCCTTGGGCCTTTGGTCCCGTCTGGACGTTGCTCTACGGGATCATGGGCTACGCTTCG
TATCGTGTCGCCACCATCGGCCTCGGGCCCTTTGCCTCCCCCGAGACCGTCCGCGTCACCAGGCAAAGCTTAACG
CTATACACTGTCCAACTCGGCCTCAACCTCGCATGGATGCCCCTCTTCTTCGTCGCCAAGCGTCCCGTAGAGGCC
ACCATCGACATCGTCACCCTGCTCGGCCTCAATGGCTACCTGGCCTACCTGTGGCATTCGGTCGACCACGTAGCC
GGCCTGTGTCAGGTGCCTTATATCGGCTGGCTGAGCTTTGCCACCTATCTGTGCGCTGGCGCCGGATACCTCAAC
GACTGGGACCTTTCAGACAAGACGGCTCGCGTGGCTGACAAGGAGAAGTAG
Gene >Ophcf2|07265
ATGACAACCTACATGTCAAGCATCACCATCCCGGCCGCCGTGCTCCAGCACCCGGCCGCCTCGGTTCTTCTCCCC
GTCGCCCTCGGCACCGCCGTCGGCTTCGGCACTCGCCGTAAGCACCCGTCATCCGTCTTCTCCTCTCCCGTCTCT
TGTCACGGTATAAACTGAAGAAGCGGATTCTCTGTCGCCTTGATCTGTCGACGATGCAGCTTCTGAGACGAAAAA
GACATACCTCGCTCTTAAGCAGCCGCCGCTGCGACCTCCGCCTTGGGCCTTTGGTCCCGTCTGGACGTTGCTCTA
CGGGTAGGCCGTGTCATTCTCGAGGGATTCTCTTCGCACCGGCTGAAGCTCGTCGTCTTGCGTCATCGCTCTAGG
ATCATGGGCTACGCTTCGTATCGTGTCGCCACCATCGGCCTCGGGCCCTTTGCCTCCCCCGAGACCGTCCGCGTC
ACCAGGCAAAGCTTAACGCTATACACTGTCCAACTCGGCCTCAACCTCGCATGGATGCCCCTCTTCTTCGTCGCC
AAGCGTCCCGTAGAGGCCACCATCGACATCGTCACCCTGCTCGGCCTCAATGGCTACCTGGCCTACCTGTGGCAT
TCGGTCGACCACGTAGCCGGCCTGTGTCAGGTGCCTTATATCGGCTGGCTGAGCTTTGCCACCTATCTGTGCGCT
GGCGCCGGATACCTCAACGACTGGGACCTTTCAGACAAGACGGCTCGCGTGGCTGACAAGGAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail