Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07247
Gene name
Locationscaffold_09:1021185..1021914
Strand-
Gene length (bp)729
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 1.5E-45 20 196

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 169 191 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 237.71 137.47 337.95
Alive In ants, during behavior modification 253.69 143.47 363.92
Dead In ants, recently dead 240.49 138.47 342.50

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.781048 no
Alive Dead 0.790427 no
Dead Fungus 0.962493 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07247
MRPPSSLLAATLLASAAAAHNIVLPAHGLECFHENLHSEDTMTVTYQIGDREFGSAGNLDIDFWITNPVGGYEIS
EKTVSNGDHSFTAKHDGKYTYCFSNQHWGATSKEVSFNVHGIVYVSESDMPSDPIEVEVRHLSELLAQVKDEQQY
IIVREHTHRNTAESTNARVKWWNLFVIGVVVGESLFQIWWLRRFFEVKRVV*
Coding >Ophcf2|07247
ATGCGTCCGCCCTCATCCCTCCTGGCAGCAACGCTGCTCGCCTCCGCAGCAGCAGCGCACAACATCGTCCTCCCC
GCCCACGGCCTCGAATGCTTCCATGAGAATCTGCACAGCGAGGATACCATGACGGTGACGTACCAGATCGGGGAC
CGCGAGTTTGGCAGCGCAGGCAACCTCGATATCGACTTTTGGATAACCAACCCCGTCGGCGGCTACGAAATCAGC
GAAAAGACAGTCTCCAACGGCGACCACTCCTTCACCGCAAAGCACGACGGCAAATACACCTACTGCTTCAGCAAC
CAACACTGGGGCGCCACCAGCAAAGAAGTCTCCTTCAACGTCCACGGCATCGTCTACGTCAGCGAGTCCGACATG
CCCTCGGACCCCATCGAAGTAGAAGTCCGTCATCTCTCCGAACTCCTCGCCCAAGTCAAGGACGAGCAGCAGTAC
ATCATTGTTCGCGAACACACCCACCGCAACACCGCCGAGAGCACAAACGCCCGCGTCAAGTGGTGGAACCTCTTC
GTCATCGGCGTCGTCGTCGGCGAGTCGCTCTTCCAGATCTGGTGGCTACGTCGCTTCTTCGAGGTCAAGCGCGTC
GTTTGA
Transcript >Ophcf2|07247
ATGCGTCCGCCCTCATCCCTCCTGGCAGCAACGCTGCTCGCCTCCGCAGCAGCAGCGCACAACATCGTCCTCCCC
GCCCACGGCCTCGAATGCTTCCATGAGAATCTGCACAGCGAGGATACCATGACGGTGACGTACCAGATCGGGGAC
CGCGAGTTTGGCAGCGCAGGCAACCTCGATATCGACTTTTGGATAACCAACCCCGTCGGCGGCTACGAAATCAGC
GAAAAGACAGTCTCCAACGGCGACCACTCCTTCACCGCAAAGCACGACGGCAAATACACCTACTGCTTCAGCAAC
CAACACTGGGGCGCCACCAGCAAAGAAGTCTCCTTCAACGTCCACGGCATCGTCTACGTCAGCGAGTCCGACATG
CCCTCGGACCCCATCGAAGTAGAAGTCCGTCATCTCTCCGAACTCCTCGCCCAAGTCAAGGACGAGCAGCAGTAC
ATCATTGTTCGCGAACACACCCACCGCAACACCGCCGAGAGCACAAACGCCCGCGTCAAGTGGTGGAACCTCTTC
GTCATCGGCGTCGTCGTCGGCGAGTCGCTCTTCCAGATCTGGTGGCTACGTCGCTTCTTCGAGGTCAAGCGCGTC
GTTTGA
Gene >Ophcf2|07247
ATGCGTCCGCCCTCATCCCTCCTGGCAGCAACGCTGCTCGCCTCCGCAGCAGCAGCGCACAACATCGTCCTCCCC
GCCCACGGCCTCGAATGCTTCCATGAGAATCTGCACAGCGAGGATACCATGACGGTGACGTACCAGATCGGGGAC
CGCGAGTTTGGCAGCGCAGGCAACCTCGATATCGACTTTTGGGTACTTCCTTTTACTGCTTGGGGTAAATGAGGA
CAGCTGGCTTACGCAGATACATAGATAACCAACCCCGTCGGCGGCTACGAAATCAGCGAAAAGACAGTCTCCAAC
GGCGACCACTCCTTCACCGCAAAGCACGACGGCAAATACACCTACTGCTTCAGCAACCAACACTGGGGCGCCACC
AGCAAAGAAGTCTCCTTCAACGTCCACGGCATCGTCTACGTCAGCGAGTCCGACATGCCCTCGGACCCCATCGAA
GTAGAAGGTATCCATCCCATCTTCTTCTTCTCCTCTGCTCCCGGCCCCGGCTTCTGCTAAGCTACATCAACAGTC
CGTCATCTCTCCGAACTCCTCGCCCAAGTCAAGGACGAGCAGCAGTACATCATTGTTCGCGAACACACCCACCGC
AACACCGCCGAGAGCACAAACGCCCGCGTCAAGTGGTGGAACCTCTTCGTCATCGGCGTCGTCGTCGGCGAGTCG
CTCTTCCAGATCTGGTGGCTACGTCGCTTCTTCGAGGTCAAGCGCGTCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail