Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07246
Gene name
Locationscaffold_09:1017989..1020506
Strand+
Gene length (bp)2517
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11885 DUF3405 Protein of unknown function (DUF3405) 3.0E-228 251 812

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 98 120 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 23.98 13.26 34.70
Alive In ants, during behavior modification 35.80 19.85 51.76
Dead In ants, recently dead 53.35 29.75 76.94

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.038708 yes
Alive Dead 0.015283 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07246
MGPVSNPLRSREQRLPLYQKIDPSTKERYSDDGFESPISDTESDHTLAAVSPCRSRDVSHSASKSHFLLSRRRPV
LSPLSPRKAALYPYRLPTRISRYVFLGVLGILVLMILSLIRASQVENWKVVNGKVSLAPPPPPVWEKFPFLERYY
GGLRQLRPYNESEPQYPRPADPRSPPVLSRGRVAARDAVPPSKSWQHFPGRSAESDIRECFLDNDGKVRPPPLRY
YEGRPLGFPENVAGSYDLLKLPQDICFERFGRLGPYGLGYSIGDGGLGTSEHGDREGSETVWEETRQVDYRRVDW
ASVQRQCFDANADRFSELPESTPAPHGFYVGADRPTELQNRDVAVKRNSSGHGKFTRDDETDGLPIKKQARTAVV
VRCWDEYLFREDDIANMRAMITELSLASGGRYDVHLLVQVKNDAHNPIWADHEAYEKRIRDSVPKEFQGLVTLWT
ETQMLSLYQGIYDLWSRGPGLPVHGVYRGLAMAMQYFAYQHPEYDFFWQWEMDIRYTGHYHDLLSKIEDWAKEQP
RKGLWERNSRFYIPSVHGSWDDFTQMTRVQTAMSADKDQVLGVVNAAKKTTERAKPVWGPLRPSDANDWFETEGD
AMPETEYDDDRYQWGVGEEADYISLNPLFDPEGTTWLLKDDITGFNGSQPLPPRRASIITTARMSRRLLMAMHRT
TAYKKQFAFPEMWPATVALHHGFKSVFAPHPMYVDRKWPVKYMAQVYNGGRDGTSGGARTSIFGEREHNMQGISW
YYNSGFAPNLYRRWLGLTVNNDGGPDFETTADKTKKGSGVGAMPGGEGRMCLPPMLLHPVKDVEQPVQAPGDDVA
RTGDELPIRDPAA*
Coding >Ophcf2|07246
ATGGGGCCTGTCTCAAACCCTCTGCGCTCCCGCGAGCAGCGGCTGCCGCTGTACCAAAAGATCGATCCCTCTACC
AAGGAGAGATATTCCGACGACGGCTTCGAATCCCCCATATCCGACACCGAGTCCGATCATACGCTCGCTGCCGTC
TCGCCCTGTCGATCTCGAGATGTCTCTCACTCGGCCTCCAAGAGCCACTTCTTGCTGTCCAGACGGCGGCCCGTC
CTCTCTCCTCTCTCTCCCCGCAAGGCCGCCCTCTACCCCTATCGCCTGCCAACGAGGATTTCGCGCTATGTCTTC
CTTGGCGTCCTCGGCATCCTCGTCCTCATGATCCTCAGCTTGATACGCGCCAGTCAGGTCGAGAACTGGAAGGTG
GTCAACGGCAAGGTCAGCTTGGCGCCTCCTCCGCCCCCCGTCTGGGAAAAGTTTCCCTTTCTCGAGAGGTATTAT
GGCGGTCTGCGGCAATTGAGACCTTACAACGAGAGCGAGCCTCAATACCCGCGACCCGCCGACCCTCGCTCTCCG
CCGGTTCTGTCTCGGGGCCGAGTCGCGGCGCGAGACGCCGTGCCCCCGAGCAAGTCTTGGCAGCATTTCCCGGGG
AGGAGCGCCGAGTCGGATATCCGGGAATGTTTCCTCGACAACGACGGCAAAGTGCGCCCTCCGCCTCTTCGCTAC
TACGAGGGAAGACCCCTCGGCTTTCCCGAGAATGTGGCCGGCTCCTACGACCTGCTGAAGCTGCCTCAAGACATC
TGCTTCGAGCGCTTCGGTCGACTGGGCCCTTACGGCCTGGGTTACTCCATCGGAGACGGTGGCCTCGGCACCAGC
GAGCATGGCGACAGGGAGGGGTCGGAGACTGTCTGGGAAGAGACTCGGCAAGTCGACTATCGACGCGTCGACTGG
GCCAGCGTCCAGCGCCAGTGCTTCGACGCCAATGCCGATCGCTTCAGTGAGCTGCCGGAGTCGACGCCGGCGCCG
CATGGCTTCTATGTCGGTGCTGATCGACCGACGGAACTTCAAAATCGAGACGTTGCTGTCAAACGCAACAGCAGC
GGCCATGGCAAGTTCACGAGGGACGACGAGACCGACGGCCTTCCGATTAAGAAGCAGGCCAGAACGGCCGTTGTC
GTTCGATGCTGGGACGAGTACTTATTCCGCGAGGACGACATCGCCAACATGCGAGCCATGATCACGGAGCTGTCT
CTGGCATCCGGCGGGCGTTACGACGTCCACCTACTGGTGCAGGTCAAGAACGACGCCCACAATCCCATTTGGGCG
GATCATGAAGCCTACGAGAAGCGGATCCGTGATAGCGTGCCAAAGGAGTTTCAAGGATTGGTCACGCTATGGACT
GAGACGCAGATGCTGTCGCTGTATCAGGGCATCTACGACCTGTGGAGTCGCGGTCCCGGACTGCCCGTCCACGGC
GTCTACCGAGGGCTGGCGATGGCTATGCAATATTTCGCCTATCAGCACCCAGAGTACGACTTCTTCTGGCAGTGG
GAGATGGACATTCGCTACACCGGTCACTATCACGACCTGCTGAGCAAGATCGAGGATTGGGCCAAGGAGCAGCCA
AGGAAGGGTCTCTGGGAGCGCAACTCGCGCTTCTACATCCCCTCCGTTCACGGTTCCTGGGACGACTTTACGCAG
ATGACGCGCGTGCAGACGGCGATGAGCGCGGACAAGGACCAGGTTCTTGGTGTCGTCAATGCGGCCAAGAAGACG
ACGGAGCGTGCCAAGCCGGTATGGGGGCCCCTTCGCCCCTCAGACGCGAACGACTGGTTCGAGACGGAGGGCGAT
GCCATGCCCGAGACGGAATACGATGACGATCGCTACCAGTGGGGCGTTGGGGAAGAGGCCGACTACATCTCGCTG
AACCCGCTCTTCGACCCGGAGGGCACGACGTGGCTGCTCAAGGACGACATCACTGGCTTCAACGGGTCACAGCCG
CTGCCTCCGCGACGGGCGTCTATCATCACGACGGCCCGCATGTCTCGCCGGCTGCTCATGGCTATGCACCGCACG
ACGGCCTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTGGCCCTCCATCACGGCTTCAAGTCG
GTCTTTGCGCCTCATCCGATGTACGTCGACCGCAAGTGGCCGGTCAAGTACATGGCACAAGTCTACAACGGAGGC
CGTGATGGCACCAGCGGCGGCGCGCGGACGAGCATCTTTGGCGAGCGCGAGCACAACATGCAGGGCATCAGCTGG
TACTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCACCGTCAATAACGACGGCGGCCCC
GACTTTGAGACGACGGCCGACAAGACGAAGAAGGGCTCTGGCGTCGGTGCCATGCCAGGAGGAGAGGGCCGCATG
TGTCTTCCGCCCATGCTGCTCCATCCCGTCAAGGACGTCGAGCAGCCGGTTCAGGCGCCGGGAGATGACGTGGCC
CGGACAGGGGACGAGCTGCCCATCCGGGATCCGGCCGCGTGA
Transcript >Ophcf2|07246
ATGGGGCCTGTCTCAAACCCTCTGCGCTCCCGCGAGCAGCGGCTGCCGCTGTACCAAAAGATCGATCCCTCTACC
AAGGAGAGATATTCCGACGACGGCTTCGAATCCCCCATATCCGACACCGAGTCCGATCATACGCTCGCTGCCGTC
TCGCCCTGTCGATCTCGAGATGTCTCTCACTCGGCCTCCAAGAGCCACTTCTTGCTGTCCAGACGGCGGCCCGTC
CTCTCTCCTCTCTCTCCCCGCAAGGCCGCCCTCTACCCCTATCGCCTGCCAACGAGGATTTCGCGCTATGTCTTC
CTTGGCGTCCTCGGCATCCTCGTCCTCATGATCCTCAGCTTGATACGCGCCAGTCAGGTCGAGAACTGGAAGGTG
GTCAACGGCAAGGTCAGCTTGGCGCCTCCTCCGCCCCCCGTCTGGGAAAAGTTTCCCTTTCTCGAGAGGTATTAT
GGCGGTCTGCGGCAATTGAGACCTTACAACGAGAGCGAGCCTCAATACCCGCGACCCGCCGACCCTCGCTCTCCG
CCGGTTCTGTCTCGGGGCCGAGTCGCGGCGCGAGACGCCGTGCCCCCGAGCAAGTCTTGGCAGCATTTCCCGGGG
AGGAGCGCCGAGTCGGATATCCGGGAATGTTTCCTCGACAACGACGGCAAAGTGCGCCCTCCGCCTCTTCGCTAC
TACGAGGGAAGACCCCTCGGCTTTCCCGAGAATGTGGCCGGCTCCTACGACCTGCTGAAGCTGCCTCAAGACATC
TGCTTCGAGCGCTTCGGTCGACTGGGCCCTTACGGCCTGGGTTACTCCATCGGAGACGGTGGCCTCGGCACCAGC
GAGCATGGCGACAGGGAGGGGTCGGAGACTGTCTGGGAAGAGACTCGGCAAGTCGACTATCGACGCGTCGACTGG
GCCAGCGTCCAGCGCCAGTGCTTCGACGCCAATGCCGATCGCTTCAGTGAGCTGCCGGAGTCGACGCCGGCGCCG
CATGGCTTCTATGTCGGTGCTGATCGACCGACGGAACTTCAAAATCGAGACGTTGCTGTCAAACGCAACAGCAGC
GGCCATGGCAAGTTCACGAGGGACGACGAGACCGACGGCCTTCCGATTAAGAAGCAGGCCAGAACGGCCGTTGTC
GTTCGATGCTGGGACGAGTACTTATTCCGCGAGGACGACATCGCCAACATGCGAGCCATGATCACGGAGCTGTCT
CTGGCATCCGGCGGGCGTTACGACGTCCACCTACTGGTGCAGGTCAAGAACGACGCCCACAATCCCATTTGGGCG
GATCATGAAGCCTACGAGAAGCGGATCCGTGATAGCGTGCCAAAGGAGTTTCAAGGATTGGTCACGCTATGGACT
GAGACGCAGATGCTGTCGCTGTATCAGGGCATCTACGACCTGTGGAGTCGCGGTCCCGGACTGCCCGTCCACGGC
GTCTACCGAGGGCTGGCGATGGCTATGCAATATTTCGCCTATCAGCACCCAGAGTACGACTTCTTCTGGCAGTGG
GAGATGGACATTCGCTACACCGGTCACTATCACGACCTGCTGAGCAAGATCGAGGATTGGGCCAAGGAGCAGCCA
AGGAAGGGTCTCTGGGAGCGCAACTCGCGCTTCTACATCCCCTCCGTTCACGGTTCCTGGGACGACTTTACGCAG
ATGACGCGCGTGCAGACGGCGATGAGCGCGGACAAGGACCAGGTTCTTGGTGTCGTCAATGCGGCCAAGAAGACG
ACGGAGCGTGCCAAGCCGGTATGGGGGCCCCTTCGCCCCTCAGACGCGAACGACTGGTTCGAGACGGAGGGCGAT
GCCATGCCCGAGACGGAATACGATGACGATCGCTACCAGTGGGGCGTTGGGGAAGAGGCCGACTACATCTCGCTG
AACCCGCTCTTCGACCCGGAGGGCACGACGTGGCTGCTCAAGGACGACATCACTGGCTTCAACGGGTCACAGCCG
CTGCCTCCGCGACGGGCGTCTATCATCACGACGGCCCGCATGTCTCGCCGGCTGCTCATGGCTATGCACCGCACG
ACGGCCTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTGGCCCTCCATCACGGCTTCAAGTCG
GTCTTTGCGCCTCATCCGATGTACGTCGACCGCAAGTGGCCGGTCAAGTACATGGCACAAGTCTACAACGGAGGC
CGTGATGGCACCAGCGGCGGCGCGCGGACGAGCATCTTTGGCGAGCGCGAGCACAACATGCAGGGCATCAGCTGG
TACTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCACCGTCAATAACGACGGCGGCCCC
GACTTTGAGACGACGGCCGACAAGACGAAGAAGGGCTCTGGCGTCGGTGCCATGCCAGGAGGAGAGGGCCGCATG
TGTCTTCCGCCCATGCTGCTCCATCCCGTCAAGGACGTCGAGCAGCCGGTTCAGGCGCCGGGAGATGACGTGGCC
CGGACAGGGGACGAGCTGCCCATCCGGGATCCGGCCGCGTGA
Gene >Ophcf2|07246
ATGGGGCCTGTCTCAAACCCTCTGCGCTCCCGCGAGCAGCGGCTGCCGCTGTACCAAAAGATCGATCCCTCTACC
AAGGAGAGATATTCCGACGACGGCTTCGAATCCCCCATATCCGACACCGAGTCCGATCATACGCTCGCTGCCGTC
TCGCCCTGTCGATCTCGAGATGTCTCTCACTCGGCCTCCAAGAGCCACTTCTTGCTGTCCAGACGGCGGCCCGTC
CTCTCTCCTCTCTCTCCCCGCAAGGCCGCCCTCTACCCCTATCGCCTGCCAACGAGGATTTCGCGCTATGTCTTC
CTTGGCGTCCTCGGCATCCTCGTCCTCATGATCCTCAGCTTGATACGCGCCAGTCAGGTCGAGAACTGGAAGGTG
GTCAACGGCAAGGTCAGCTTGGCGCCTCCTCCGCCCCCCGTCTGGGAAAAGTTTCCCTTTCTCGAGAGGTATTAT
GGCGGTCTGCGGCAATTGAGACCTTACAACGAGAGCGAGCCTCAATACCCGCGACCCGCCGACCCTCGCTCTCCG
CCGGTTCTGTCTCGGGGCCGAGTCGCGGCGCGAGACGCCGTGCCCCCGAGCAAGTCTTGGCAGCATTTCCCGGGG
AGGAGCGCCGAGTCGGATATCCGGGAATGTTTCCTCGACAACGACGGCAAAGTGCGCCCTCCGCCTCTTCGCTAC
TACGAGGGAAGACCCCTCGGCTTTCCCGAGAATGTGGCCGGCTCCTACGACCTGCTGAAGCTGCCTCAAGACATC
TGCTTCGAGCGCTTCGGTCGACTGGGCCCTTACGGCCTGGGTTACTCCATCGGAGACGGTGGCCTCGGCACCAGC
GAGCATGGCGACAGGGAGGGGTCGGAGACTGTCTGGGAAGAGACTCGGCAAGTCGACTATCGACGCGTCGACTGG
GCCAGCGTCCAGCGCCAGTGCTTCGACGCCAATGCCGATCGCTTCAGTGAGCTGCCGGAGTCGACGCCGGCGCCG
CATGGCTTCTATGTCGGTGCTGATCGACCGACGGAACTTCAAAATCGAGACGTTGCTGTCAAACGCAACAGCAGC
GGCCATGGCAAGTTCACGAGGGACGACGAGACCGACGGCCTTCCGATTAAGAAGCAGGCCAGAACGGCCGTTGTC
GTTCGATGCTGGGACGAGTACTTATTCCGCGAGGACGACATCGCCAACATGCGAGCCATGATCACGGAGCTGTCT
CTGGCATCCGGCGGGCGTTACGACGTCCACCTACTGGTGCAGGTCAAGAACGACGCCCACAATCCCATTTGGGCG
GATCATGAAGCCTACGAGAAGCGGATCCGTGATAGCGTGCCAAAGGAGTTTCAAGGATTGGTCACGCTATGGACT
GAGACGCAGATGCTGTCGCTGTATCAGGGCATCTACGACCTGTGGAGTCGCGGTCCCGGACTGCCCGTCCACGGC
GTCTACCGAGGGCTGGCGATGGCTATGCAATATTTCGCCTATCAGCACCCAGAGTACGACTTCTTCTGGCAGTGG
GAGATGGACATTCGCTACACCGGTCACTATCACGACCTGCTGAGCAAGATCGAGGATTGGGCCAAGGAGCAGCCA
AGGAAGGGTCTCTGGGAGCGCAACTCGCGCTTCTACATCCCCTCCGTTCACGGTTCCTGGGACGACTTTACGCAG
ATGACGCGCGTGCAGACGGCGATGAGCGCGGACAAGGACCAGGTTCTTGGTGTCGTCAATGCGGCCAAGAAGACG
ACGGAGCGTGCCAAGCCGGTATGGGGGCCCCTTCGCCCCTCAGACGCGAACGACTGGTTCGAGACGGAGGGCGAT
GCCATGCCCGAGACGGAATACGATGACGATCGCTACCAGTGGGGCGTTGGGGAAGAGGCCGACTACATCTCGCTG
AACCCGCTCTTCGACCCGGAGGGCACGACGTGGCTGCTCAAGGACGACATCACTGGCTTCAACGGGTCACAGCCG
CTGCCTCCGCGACGGGCGTCTATCATCACGACGGCCCGCATGTCTCGCCGGCTGCTCATGGCTATGCACCGCACG
ACGGCCTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTGGCCCTCCATCACGGCTTCAAGTCG
GTCTTTGCGCCTCATCCGATGTACGTCGACCGCAAGTGGCCGGTCAAGTACATGGCACAAGTCTACAACGGAGGC
CGTGATGGCACCAGCGGCGGCGCGCGGACGAGCATCTTTGGCGAGCGCGAGCACAACATGCAGGGCATCAGCTGG
TACTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCACCGTCAATAACGACGGCGGCCCC
GACTTTGAGACGACGGCCGACAAGACGAAGAAGGGCTCTGGCGTCGGTGCCATGCCAGGAGGAGAGGGCCGCATG
TGTCTTCCGCCCATGCTGCTCCATCCCGTCAAGGACGTCGAGCAGCCGGTTCAGGCGCCGGGAGATGACGTGGCC
CGGACAGGGGACGAGCTGCCCATCCGGGATCCGGCCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail