Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07237
Gene name
Locationscaffold_09:995357..997140
Strand-
Gene length (bp)1783
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 108 127 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 17.44 8.67 26.22
Alive In ants, during behavior modification 128.29 68.38 188.20
Dead In ants, recently dead 127.43 69.85 185.01

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.978267 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07237
MTPKMMVAPPRINLRRAASYNNSQQQQHQHQHQHQHQQQQQQQQQQRQQQQHDAGGPLSATSRFGFEHVVFLASS
PPPSPSLPRPRGRRTWSRAGARARTKKRRVRRVLCSGGVVLLALWIVARLFCRSGGSLADGPRPLLSHHRKPDPN
YVDVDEAERAGLLPSAGAGAGAGAGAGAGTEQRSGHFVGLDVAAAAEKPVCTSSLTVLLESSDAGLGRSLLMLWM
LYALAAEQQRAFFVDDSRWAYGRYGDLLQPPPLPACRPPPRHEMVPCPAQARHLVVSASTASDVLLEGGHGGEGS
TRRLLGLAGVGYRRLFALVEDDAGYVERRVRQLRERAGGAPVVGLHIRRGDRHPFEFQYRDTYIPIEVFADRARG
LVEAHYNETRTTKGGEAVTVLASDDPTVLHGQSDLSDAVLAQQRIRLASGAEEQPSKTRTSPDPRFMHRFTDEGH
GWEGGFFSLVFWNLGAQRKNNAIPQDDDEAGGPPSDQTLRLRGFVARAYMMDLAVLAGASDKVVCAVSAMGCRLL
AVMMGWERAFEQGGG*
Coding >Ophcf2|07237
ATGACGCCCAAGATGATGGTTGCGCCCCCGCGCATCAACCTGCGGCGCGCCGCCTCGTACAACAACAGCCAGCAA
CAGCAGCATCAGCATCAGCATCAGCATCAGCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACGGCAGCAGCAG
CAGCACGACGCAGGCGGGCCGCTATCCGCCACCTCTCGCTTCGGGTTCGAACACGTCGTCTTCCTAGCCTCGTCG
CCGCCACCGTCTCCGAGTCTGCCGCGTCCACGGGGGAGGCGGACGTGGTCGCGGGCGGGTGCGAGGGCGAGGACG
AAGAAGAGGAGGGTTAGGAGGGTGCTTTGCTCGGGGGGAGTGGTGCTGCTCGCGCTTTGGATCGTTGCCAGGCTG
TTTTGTCGGTCGGGGGGGAGTTTGGCCGATGGACCGCGGCCGTTGTTATCCCATCATCGGAAGCCGGATCCGAAT
TACGTCGACGTCGATGAGGCGGAGCGGGCTGGTCTTTTACCCTCCGCCGGAGCCGGAGCCGGAGCCGGAGCCGGA
GCAGGAGCCGGGACGGAGCAACGGAGCGGACACTTTGTCGGGCTGGACGTCGCTGCCGCAGCGGAGAAGCCGGTC
TGTACATCTTCGCTCACCGTCCTTCTCGAGAGTTCGGACGCGGGACTCGGTCGGTCGCTGTTGATGCTCTGGATG
CTCTACGCGCTGGCCGCGGAACAGCAGAGGGCCTTTTTCGTCGACGACTCGCGTTGGGCTTATGGACGGTACGGC
GATCTGCTGCAGCCGCCGCCTCTGCCGGCTTGCAGGCCTCCTCCTCGACACGAGATGGTGCCGTGTCCGGCCCAG
GCGCGTCACCTTGTCGTCTCGGCGTCTACGGCCTCGGACGTGCTCCTCGAGGGGGGGCATGGAGGAGAGGGCAGT
ACCAGGCGGTTGCTGGGGTTGGCGGGGGTCGGATACCGGCGGTTGTTTGCCCTGGTTGAAGACGATGCTGGCTAT
GTTGAGAGGAGGGTGAGGCAGTTGAGGGAGAGGGCTGGGGGGGCGCCCGTCGTGGGTCTTCATATTCGGAGGGGG
GATCGACATCCGTTCGAGTTTCAGTATCGCGATACGTATATCCCCATCGAGGTCTTTGCCGATCGGGCGAGGGGG
TTGGTTGAGGCTCACTATAACGAGACGAGGACTACCAAGGGGGGGGAGGCTGTTACCGTTCTGGCATCTGATGAT
CCGACTGTTCTCCATGGACAGAGCGATCTCTCCGACGCGGTTCTCGCTCAGCAGCGCATCCGTCTGGCATCCGGC
GCCGAGGAACAACCCAGCAAGACGAGGACGAGTCCGGATCCTCGCTTCATGCACCGCTTCACAGACGAGGGCCAC
GGCTGGGAAGGCGGCTTCTTCTCCCTCGTATTCTGGAACCTGGGCGCCCAACGAAAGAACAACGCCATTCCGCAA
GACGACGACGAAGCCGGCGGGCCGCCCTCGGACCAGACCTTGCGGCTGAGAGGCTTCGTCGCGCGCGCCTACATG
ATGGACTTGGCTGTGCTGGCGGGCGCGAGCGACAAGGTTGTCTGCGCCGTCAGCGCCATGGGGTGCAGGCTCTTG
GCCGTCATGATGGGCTGGGAGCGGGCGTTTGAGCAGGGGGGTGGGTGA
Transcript >Ophcf2|07237
ATGACGCCCAAGATGATGGTTGCGCCCCCGCGCATCAACCTGCGGCGCGCCGCCTCGTACAACAACAGCCAGCAA
CAGCAGCATCAGCATCAGCATCAGCATCAGCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACGGCAGCAGCAG
CAGCACGACGCAGGCGGGCCGCTATCCGCCACCTCTCGCTTCGGGTTCGAACACGTCGTCTTCCTAGCCTCGTCG
CCGCCACCGTCTCCGAGTCTGCCGCGTCCACGGGGGAGGCGGACGTGGTCGCGGGCGGGTGCGAGGGCGAGGACG
AAGAAGAGGAGGGTTAGGAGGGTGCTTTGCTCGGGGGGAGTGGTGCTGCTCGCGCTTTGGATCGTTGCCAGGCTG
TTTTGTCGGTCGGGGGGGAGTTTGGCCGATGGACCGCGGCCGTTGTTATCCCATCATCGGAAGCCGGATCCGAAT
TACGTCGACGTCGATGAGGCGGAGCGGGCTGGTCTTTTACCCTCCGCCGGAGCCGGAGCCGGAGCCGGAGCCGGA
GCAGGAGCCGGGACGGAGCAACGGAGCGGACACTTTGTCGGGCTGGACGTCGCTGCCGCAGCGGAGAAGCCGGTC
TGTACATCTTCGCTCACCGTCCTTCTCGAGAGTTCGGACGCGGGACTCGGTCGGTCGCTGTTGATGCTCTGGATG
CTCTACGCGCTGGCCGCGGAACAGCAGAGGGCCTTTTTCGTCGACGACTCGCGTTGGGCTTATGGACGGTACGGC
GATCTGCTGCAGCCGCCGCCTCTGCCGGCTTGCAGGCCTCCTCCTCGACACGAGATGGTGCCGTGTCCGGCCCAG
GCGCGTCACCTTGTCGTCTCGGCGTCTACGGCCTCGGACGTGCTCCTCGAGGGGGGGCATGGAGGAGAGGGCAGT
ACCAGGCGGTTGCTGGGGTTGGCGGGGGTCGGATACCGGCGGTTGTTTGCCCTGGTTGAAGACGATGCTGGCTAT
GTTGAGAGGAGGGTGAGGCAGTTGAGGGAGAGGGCTGGGGGGGCGCCCGTCGTGGGTCTTCATATTCGGAGGGGG
GATCGACATCCGTTCGAGTTTCAGTATCGCGATACGTATATCCCCATCGAGGTCTTTGCCGATCGGGCGAGGGGG
TTGGTTGAGGCTCACTATAACGAGACGAGGACTACCAAGGGGGGGGAGGCTGTTACCGTTCTGGCATCTGATGAT
CCGACTGTTCTCCATGGACAGAGCGATCTCTCCGACGCGGTTCTCGCTCAGCAGCGCATCCGTCTGGCATCCGGC
GCCGAGGAACAACCCAGCAAGACGAGGACGAGTCCGGATCCTCGCTTCATGCACCGCTTCACAGACGAGGGCCAC
GGCTGGGAAGGCGGCTTCTTCTCCCTCGTATTCTGGAACCTGGGCGCCCAACGAAAGAACAACGCCATTCCGCAA
GACGACGACGAAGCCGGCGGGCCGCCCTCGGACCAGACCTTGCGGCTGAGAGGCTTCGTCGCGCGCGCCTACATG
ATGGACTTGGCTGTGCTGGCGGGCGCGAGCGACAAGGTTGTCTGCGCCGTCAGCGCCATGGGGTGCAGGCTCTTG
GCCGTCATGATGGGCTGGGAGCGGGCGTTTGAGCAGGGGGGTGGGTGA
Gene >Ophcf2|07237
ATGACGCCCAAGATGATGGTTGCGCCCCCGCGCATCAACCTGCGGCGCGCCGCCTCGTACAACAACAGCCAGCAA
CAGCAGCATCAGCATCAGCATCAGCATCAGCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACGGCAGCAGCAG
CAGCACGACGCAGGCGGGCCGCTATCCGCCACCTCTCGCTTCGGGTTCGAACACGTCGTCTTCCTAGCCTCGTCG
CCGCCACCGTCTCCGAGTCTGCCGCGTCCACGGGGGAGGCGGACGTGGTCGCGGGCGGGTGCGAGGGCGAGGACG
AAGAAGAGGAGGGTTAGGAGGGTGCTTTGCTCGGGGGGAGTGGTGCTGCTCGCGCTTTGGATCGTTGCCAGGCTG
TTTTGTCGGTCGGGGGGGAGGTTGGCAGGGGGAGAATCGAGTGCCTGATTTTCCGGCGCCGGTTGTGGTCGGGGG
GAAGGTGACGAGATGGACTGTTTCGATTCCGAGGGGGGTTTCGTTTCCGCTTTCTATGTCGAGGTATGCTGCTAT
GGCTCATCAGTGTCGACTTGTGGCTGCTAGTTTGGCCGATGGACCGCGGCCGTTGTTATCCCATCATCGGAAGCC
GGATCCGAATTACGTCGACGTCGATGAGGCGGAGCGGGCTGGTCTTTTACCCTCCGCCGGAGCCGGAGCCGGAGC
CGGAGCCGGAGCAGGAGCCGGGACGGAGCAACGGAGCGGACACTTTGTCGGGCTGGACGTCGCTGCCGCAGCGGA
GAAGCCGGTCTGTACATCTTCGCTCACCGTCCTTCTCGAGAGTTCGGACGCGGGACTCGGTCGGTCGCTGTTGAT
GCTCTGGATGCTCTACGCGCTGGCCGCGGAACAGCAGAGGGCCTTTTTCGTCGACGACTCGCGTTGGGCTTATGG
ACGGTACGGCGATCTGCTGCAGCCGCCGCCTCTGCCGGCTTGCAGGCCTCCTCCTCGACACGAGATGGTGCCGTG
TCCGGCCCAGGCGCGTCACCTTGTCGTCTCGGCGTCTACGGCCTCGGACGTGCTCCTCGAGGGGGGGCATGGAGG
AGAGGGCAGTACCAGGCGGTTGCTGGGGTTGGCGGGGGTCGGATACCGGCGGTTGTTTGCCCTGGTTGAAGACGA
TGCTGGCTATGTTGAGAGGAGGGTGAGGCAGTTGAGGGAGAGGGCTGGGGGGGCGCCCGTCGTGGGTCTTCATAT
TCGGAGGGGGGATCGACATCCGTTCGAGTTTCAGTATCGCGATACGTATATCCCCATCGAGGTCTTTGCCGATCG
GGCGAGGGGGTTGGTTGAGGCTCACTATAACGAGACGAGGACTACCAAGGGGGGGGAGGCTGTTACCGTTCTGGC
ATCTGATGATCCGACTGTTCTCCATGGACAGAGCGATCTCTCCGACGCGGTTCTCGCTCAGCAGCGCATCCGTCT
GGCATCCGGCGCCGAGGAACAACCCAGCAAGACGAGGACGAGTCCGGATCCTCGCTTCATGCACCGCTTCACAGA
CGAGGGCCACGGCTGGGAAGGCGGCTTCTTCTCCCTCGTATTCTGGAACCTGGGCGCCCAACGAAAGAACAACGC
CATTCCGCAAGACGACGACGAAGCCGGCGGGCCGCCCTCGGACCAGACCTTGCGGCTGAGAGGCTTCGTCGCGCG
CGCCTACATGATGGACTTGGCTGTGCTGGCGGGCGCGAGCGACAAGGTTGTCTGCGCCGTCAGCGCCATGGGGTG
CAGGCTCTTGGCCGTCATGATGGGCTGGGAGCGGGCGTTTGAGCAGGGGGGTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail