Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07235
Gene name
Locationscaffold_09:989627..993134
Strand+
Gene length (bp)3507
Transcript length (bp)2112
Coding sequence length (bp)2112
Protein length (aa) 704

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.6E-20 64 274

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1515 0.1462 0.9323 0.1673 0.0914 0.0165 0.2068 0.1103 0.1766 0.0014

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.993141

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5840
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|419
Ophiocordyceps australis map64 (Brazil) OphauB2|2175
Ophiocordyceps camponoti-floridani Ophcf2|03909
Ophiocordyceps camponoti-floridani Ophcf2|07235 (this protein)
Ophiocordyceps kimflemingae Ophio5|2590

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07235
MKHSQLFPVICMTALLCPIHCTTANVSIPGLSKRQEAPPVVPKLERIERDAEKPKICLRGEIIRTPEQVEAAGGF
YARGWKVRDNIPPAAQEVASSLYSHAKGDALPCSLYISGTTDAKTALASARIEKLPDDVGHVYRFRATKKTVDMN
RSLGKYSPFPEQFEQSTIGFISWEDVEGHYVITNDMVSDDKKKKALVRNLQEGTQEGFVPNPKYRPKSAGTTGSG
ASPQLAGFPEHHTAWSEKKWKPFKDKSVKETLQSMTQFLCRSRKRDLSCLARVAPKPVPSKVSRTRERKYRNAAR
VLMRGHGRIGPDDISSAFDFFFTMSDHNARHVICYSDEVEPDGSCPLPEGYTSNSKVAEEVARWSNSEIAERIAY
GPPPKVIDRWSNTDILDMQWAKIRQAWHLKAKKDSAPPQVETWESPNPDPPQTKDHRDHKPFDFESTYTDRSKTE
GKPPKVTSCNSKDFWSVSSQTLDDVKQGRLACGHANGDPHHYWRWLHRCQIQHCQPSAKGEVHCSDIPVDTTAWD
DGEKGYGSKVMGSDRLMRLHDDFGHSGVLPPEQHQDWIIPCAITTKPETTTHKQQPPPPTNNNNNNNNNPSYQTQ
TPTHRIQEAINSTRRWHRDHKTTPLSEADFVARYLRQQSKRDPPMAVLIQRALRRRVRGRYRRGEGRPASLDDFC
RAVVWRDVIETVERVLVREGGVHEALGG*
Coding >Ophcf2|07235
ATGAAGCACTCTCAGCTGTTTCCGGTCATTTGCATGACTGCTCTACTCTGTCCAATTCATTGCACCACCGCAAAT
GTTTCCATCCCAGGCCTATCCAAACGTCAGGAAGCTCCACCAGTCGTACCCAAGCTGGAGAGGATCGAAAGAGAT
GCCGAGAAACCAAAGATTTGCCTCCGCGGCGAAATCATCCGAACGCCGGAACAGGTCGAGGCTGCGGGAGGCTTC
TACGCGAGAGGCTGGAAGGTGAGGGATAACATACCCCCAGCAGCGCAAGAAGTCGCCAGCAGCCTCTATTCCCAT
GCAAAGGGGGATGCCCTACCTTGTTCGCTGTACATTTCTGGAACGACGGATGCGAAGACTGCCCTGGCCAGTGCC
CGGATTGAGAAACTGCCTGATGACGTCGGGCATGTCTATCGGTTTAGGGCGACGAAGAAGACGGTCGATATGAAT
CGTTCTTTGGGGAAATACTCGCCATTCCCTGAGCAGTTTGAACAATCGACGATTGGCTTCATTTCCTGGGAGGAT
GTGGAAGGGCATTACGTTATTACCAACGACATGGTCTCAGACGACAAGAAGAAGAAGGCTCTTGTCAGAAATCTG
CAGGAAGGTACTCAGGAAGGCTTCGTCCCTAATCCCAAGTACAGGCCGAAATCCGCAGGGACTACCGGCAGCGGT
GCCTCGCCTCAGCTAGCCGGATTTCCCGAGCATCACACGGCTTGGAGCGAGAAGAAGTGGAAGCCATTCAAAGAC
AAGTCCGTCAAAGAGACTCTTCAGAGCATGACGCAATTCCTATGCAGGTCGAGGAAGAGAGACTTGAGTTGCTTG
GCGCGCGTGGCACCTAAACCGGTACCCTCCAAGGTGTCGAGAACACGGGAGCGGAAGTACAGGAACGCTGCACGG
GTGTTGATGAGAGGACATGGTAGGATCGGGCCTGATGATATCTCTAGTGCCTTTGACTTCTTTTTCACCATGAGC
GATCATAACGCACGGCATGTCATTTGCTACTCGGATGAGGTAGAGCCGGATGGGTCATGTCCTCTTCCTGAAGGT
TATACGTCGAATTCAAAAGTTGCCGAAGAAGTCGCGAGATGGTCCAACTCTGAGATTGCGGAAAGAATCGCTTAC
GGACCTCCGCCCAAGGTCATTGACCGGTGGTCGAACACGGACATCTTGGATATGCAGTGGGCCAAGATCCGTCAA
GCCTGGCATCTCAAGGCAAAGAAAGATTCAGCACCACCCCAAGTCGAGACATGGGAGTCTCCAAACCCGGACCCC
CCCCAAACCAAAGACCATCGAGACCACAAGCCCTTCGACTTCGAGTCCACCTACACAGACAGAAGCAAGACGGAG
GGAAAACCGCCCAAAGTAACGTCGTGCAACAGCAAAGACTTCTGGTCCGTCTCAAGCCAAACCCTCGACGACGTC
AAACAAGGCCGTCTAGCCTGCGGCCACGCAAACGGCGACCCGCACCATTACTGGCGCTGGCTTCACCGCTGCCAG
ATCCAACACTGCCAACCCAGCGCCAAAGGCGAAGTCCACTGCTCCGACATCCCTGTCGACACCACCGCTTGGGAC
GACGGGGAAAAGGGCTACGGTTCCAAGGTGATGGGTTCAGACCGCCTCATGCGCCTCCACGACGACTTTGGCCAT
TCCGGTGTCCTCCCTCCCGAACAACACCAGGACTGGATCATCCCTTGCGCCATCACCACCAAGCCCGAAACAACC
ACGCACAAACAACAACCCCCTCCACCAACAAACAACAACAACAACAACAACAACAACCCCAGCTACCAAACCCAA
ACACCAACCCACCGCATCCAAGAAGCCATAAACTCAACCCGCCGCTGGCACCGCGACCACAAGACGACGCCCCTG
AGCGAAGCCGACTTCGTAGCCCGCTACCTCCGCCAGCAGTCGAAGCGCGACCCCCCCATGGCCGTCCTGATACAG
CGCGCCTTGAGGAGGCGGGTTCGCGGGAGGTATCGCCGTGGTGAGGGGAGGCCGGCTTCGCTCGATGACTTTTGC
AGGGCGGTTGTTTGGAGGGATGTCATCGAGACGGTCGAGAGGGTGCTTGTTAGGGAAGGGGGGGTGCATGAGGCT
CTTGGGGGGTGA
Transcript >Ophcf2|07235
ATGAAGCACTCTCAGCTGTTTCCGGTCATTTGCATGACTGCTCTACTCTGTCCAATTCATTGCACCACCGCAAAT
GTTTCCATCCCAGGCCTATCCAAACGTCAGGAAGCTCCACCAGTCGTACCCAAGCTGGAGAGGATCGAAAGAGAT
GCCGAGAAACCAAAGATTTGCCTCCGCGGCGAAATCATCCGAACGCCGGAACAGGTCGAGGCTGCGGGAGGCTTC
TACGCGAGAGGCTGGAAGGTGAGGGATAACATACCCCCAGCAGCGCAAGAAGTCGCCAGCAGCCTCTATTCCCAT
GCAAAGGGGGATGCCCTACCTTGTTCGCTGTACATTTCTGGAACGACGGATGCGAAGACTGCCCTGGCCAGTGCC
CGGATTGAGAAACTGCCTGATGACGTCGGGCATGTCTATCGGTTTAGGGCGACGAAGAAGACGGTCGATATGAAT
CGTTCTTTGGGGAAATACTCGCCATTCCCTGAGCAGTTTGAACAATCGACGATTGGCTTCATTTCCTGGGAGGAT
GTGGAAGGGCATTACGTTATTACCAACGACATGGTCTCAGACGACAAGAAGAAGAAGGCTCTTGTCAGAAATCTG
CAGGAAGGTACTCAGGAAGGCTTCGTCCCTAATCCCAAGTACAGGCCGAAATCCGCAGGGACTACCGGCAGCGGT
GCCTCGCCTCAGCTAGCCGGATTTCCCGAGCATCACACGGCTTGGAGCGAGAAGAAGTGGAAGCCATTCAAAGAC
AAGTCCGTCAAAGAGACTCTTCAGAGCATGACGCAATTCCTATGCAGGTCGAGGAAGAGAGACTTGAGTTGCTTG
GCGCGCGTGGCACCTAAACCGGTACCCTCCAAGGTGTCGAGAACACGGGAGCGGAAGTACAGGAACGCTGCACGG
GTGTTGATGAGAGGACATGGTAGGATCGGGCCTGATGATATCTCTAGTGCCTTTGACTTCTTTTTCACCATGAGC
GATCATAACGCACGGCATGTCATTTGCTACTCGGATGAGGTAGAGCCGGATGGGTCATGTCCTCTTCCTGAAGGT
TATACGTCGAATTCAAAAGTTGCCGAAGAAGTCGCGAGATGGTCCAACTCTGAGATTGCGGAAAGAATCGCTTAC
GGACCTCCGCCCAAGGTCATTGACCGGTGGTCGAACACGGACATCTTGGATATGCAGTGGGCCAAGATCCGTCAA
GCCTGGCATCTCAAGGCAAAGAAAGATTCAGCACCACCCCAAGTCGAGACATGGGAGTCTCCAAACCCGGACCCC
CCCCAAACCAAAGACCATCGAGACCACAAGCCCTTCGACTTCGAGTCCACCTACACAGACAGAAGCAAGACGGAG
GGAAAACCGCCCAAAGTAACGTCGTGCAACAGCAAAGACTTCTGGTCCGTCTCAAGCCAAACCCTCGACGACGTC
AAACAAGGCCGTCTAGCCTGCGGCCACGCAAACGGCGACCCGCACCATTACTGGCGCTGGCTTCACCGCTGCCAG
ATCCAACACTGCCAACCCAGCGCCAAAGGCGAAGTCCACTGCTCCGACATCCCTGTCGACACCACCGCTTGGGAC
GACGGGGAAAAGGGCTACGGTTCCAAGGTGATGGGTTCAGACCGCCTCATGCGCCTCCACGACGACTTTGGCCAT
TCCGGTGTCCTCCCTCCCGAACAACACCAGGACTGGATCATCCCTTGCGCCATCACCACCAAGCCCGAAACAACC
ACGCACAAACAACAACCCCCTCCACCAACAAACAACAACAACAACAACAACAACAACCCCAGCTACCAAACCCAA
ACACCAACCCACCGCATCCAAGAAGCCATAAACTCAACCCGCCGCTGGCACCGCGACCACAAGACGACGCCCCTG
AGCGAAGCCGACTTCGTAGCCCGCTACCTCCGCCAGCAGTCGAAGCGCGACCCCCCCATGGCCGTCCTGATACAG
CGCGCCTTGAGGAGGCGGGTTCGCGGGAGGTATCGCCGTGGTGAGGGGAGGCCGGCTTCGCTCGATGACTTTTGC
AGGGCGGTTGTTTGGAGGGATGTCATCGAGACGGTCGAGAGGGTGCTTGTTAGGGAAGGGGGGGTGCATGAGGCT
CTTGGGGGGTGA
Gene >Ophcf2|07235
ATGAAGCACTCTCAGCTGTTTCCGGTCATTTGCATGACTGCTCTACTCTGTCCAATTCATTGCACCACCGCAAAT
GTTTCCATCCCAGGCCTATCCAAACGTCAGGAAGCTCCACCAGTCGTACCCAAGCTGGAGAGGATCGAAAGAGAT
GCCGAGAAACCAAAGATTTGCCTCCGCGGCGAAATCATCCGAACGCCGGAACAGGTCGAGGCTGCGGGAGGCTTC
TACGCGAGAGGCTGGAAGGTGAGGGATAACATACCCCCAGCAGCGCAAGAAGTCGCCAGCAGCCTCTATTCCCAT
GCAAAGGGGGATGCCCTACCTTGTTCGCTGTACATTTCTGGAACGACGGATGCGAAGACTGCCCTGGCCAGTGCC
CGGATTGAGAAACTGCCTGATGACGTCGGGCATGTCTATCGGTTTAGGGCGACGAAGAAGACGGTCGATATGAAT
CGTTCTTTGGGGAAATACTCGCCATTCCCTGAGCAGTTTGAACAATCGACGATTGGCTTCATTTCCTGGGAGGAT
GTGGAAGGGCATTACGTTATTACCAACGACATGGTCTCAGACGACAAGAAGAAGAAGGCTCTTGTCAGAAATCTG
CAGGAAGGTACTCAGGAAGGCTTCGTCCCTAATCCCAAGTACAGGCCGAAATCCGCAGGGACTACCGGCAGCGGT
GCCTCGCCTCAGCTAGCCGGATTTCCCGAGCATCACACGGCTTGGAGCGAGAAGAAGTGGAAGCCATTCAAAGAC
AAGTCCGTCAAAGAGACTCTTCAGAGCATGACGCAATTCCTATGCAGGTCGAGGAAGAGAGACTTGAGTTGCTTG
GCGCGCGTGGCACCTAAACCGGTACCCTCCAAGGTGTCGAGAACACGGGAGCGGAAGTACAGGAACGCTGCACGG
GTGTTGATGAGAGGACATGGTAGGATCGGGCCTGATGATATCTCTAGTGCCTTTGACTTCTTTTTCACCATGAGC
GATCATAACGCACGGCATGTCATTTGCTACTCGGATGTGAGTTGCGGCCTGATTGAGCCGAGGCACGACGATACT
TGATGTACTGACTATAATCTCAGGAGGTAGAGCCGGATGGGTCATGTCCTCTTCCTGAAGGGTACTTGTCCTCAT
CTCAAGGGCAAGAGACTGTGCTGATCAGAGAGTCATAGTTATACGTCGAATTCAAAAGTTGCCGAAGAAGTCGCG
GTATGTCACAGGCTGAATGGGCACCTTGACGGCAAACGATGGGCTGACACAACCACTGAAGAATCCAGGTTCGAG
AGTCATCGAGGTTTCGTCTATCCATCATGTCGAGAGATGCTTAGTTGCTAATGCAATGCAGAGATGGTCCAACTC
TGAGATTGCGGAAAGAATCGCTGTACGTTGGCTCTCCACAATCTCACACGCTTGATGTTTGTAACACGATAGGCT
TCTTCAGTACGGACCTCCGCCCAAGGTCATTGACGTAAGTGAGGCTCGCCAACCAGCATGAACTGGAAACTGATT
CGAGGATTCAGCGGTGGTCGAACACGGACATCTTGGATATGCAGTGGGCCAAGATCGTGAGCGGCATTCACCACG
TCTAGCAGATATAGATTTCTCTGACATGATGACAGCGTCAAGCCTGGCATCTCAAGGCAAAGAAAGATTCAGCAC
CACCCCAAGTCGAGACATGGGAGTCTCCAAACCCGGACCCCCCCCAAACCAAAGACCATCGAGACCACAAGCCCT
TCGACTTCGAGTCCACCTACACAGACAGAAGCAAGACGGAGGGAAAACCGCCCAAAGTAACGTCGTGCAACAGCA
AAGACTTCTGGTCCGTCTCAAGCCAAACCCTCGACGACGTCAAACAAGGCCGTCTAGCCTGCGGCCACGCAAACG
GCGACCCGCACCATTACTGGCGCTGGCTTCACCGCTGCCAGATCCAACACTGCCAACCCAGCGCCAAAGGCGAAG
TCCACTGCTCCGACATCCCTGTCGACACCACCGCTTGGGACGACGGGGAAAAGGGCTACGGTTCCAAGGTGATGG
GTTCAGACCGCCTCATGCGCCTCCACGACGACTTTGGCCATTCCGGTGTCCTCCCTCCCGAACAACACCAGGACT
GGATCATCCCTTGCGGTTGGCAACACGACCAGATGGAAAGAGAAAAGAAGGAGAAGAAAGACGAAAAAGGACAAA
CAGGAATAAATCATCCTCGCCAACGGGAAAGTGGGGGACCGGAGCCGCGCAGACGGAGACGGGACCGGGAGCGGG
GCCCGGGAAGCCGTCCGGAAGCGGCGAGACTTGACCAAGACTTCGGAGAGATGCCGGAAGTCTGAAGATGACATT
GCACGTACATACCAACATACATACCCATGTACGAAGTAGTCAAACCTGCGAGGAGCACATCACTAGTTGGGTCGG
TGACGAAAATAAAACACCGGCGCTGCATTCGAATCTCTACCCATCTCACTTCGGAAGGCGCGACGGCGGTTGCTC
CTACCTGACATGCACCTCCAAGCATACGTATGTATTGAGCCTCACCTTCTCCCACGTGATTCAACTTGCTTCTTC
TTCTCCTCCTCCTCCTCCTCCTCACCTCCATCACCAACCTACCAAGCGACACCATGTCCCAACAACAACGACACC
GGTCCGTCCCCCCCGAAGCCACCCCCCAGCACCCCCATCCTGACCGTCCCCCCTCACCGACCGGGACCCCCCCCC
GTCCACAGAGTCGACTCTGCAAGCGCAAGCCGACGCCCTGGCCCGCATGACGCTAGAGCTGAACCTCCGGACGGT
AGGCGCGCAGGCGGAGCGGCTGGAGGCGGAGCTGAAGGAGCTGGTGGCGCGGACGGCCGAGGATAGGGCGTTTCG
GGCCCGGCATGAGGAGAGGGTGGCCGACGTGTGGCGCGAGGTCGTTGCTGTGAAGACGCAGATGGCTGGCTTGGA
TGGGGGGGGGAGGATGGTGGTCGGGGGCACGAGGCTTGTCGTGGGCGCTTTCGCGAGTGTCAGGATGCGCTCGAG
GGTTTGAGGTGTCGGGTTATGGGCGAGGTTGAGCGGTTGACGACTCTGGTTGAGAAGGTGGGCGACCAACTCGAT
ACCCTAACCTCCAAGCAAGCCATCACCACCAAGCCCGAAACAACCACGCACAAACAACAACCCCCTCCACCAACA
AACAACAACAACAACAACAACAACAACCCCAGCTACCAAACCCAAACACCAACCCACCGCATCCAAGAAGCCATA
AACTCAACCCGCCGCTGGCACCGCGACCACAAGACGACGCCCCTGAGCGAAGCCGACTTCGTAGCCCGCTACCTC
CGCCAGCAGTCGAAGCGCGACCCCCCCATGGCCGTCCTGATACAGCGCGCCTTGAGGAGGCGGGTTCGCGGGAGG
TATCGCCGTGGTGAGGGGAGGCCGGCTTCGCTCGATGACTTTTGCAGGGCGGTTGTTTGGAGGGATGTCATCGAG
ACGGTCGAGAGGGTGCTTGTTAGGGAAGGGGGGGTGCATGAGGCTCTTGGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail