Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07220
Gene name
Locationscaffold_09:952860..953488
Strand-
Gene length (bp)628
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08561 Ribosomal_L37 Mitochondrial ribosomal protein L37 1.3E-36 51 183

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1142 0.1804 0.0158 0.0947 0.9458 0.0074 0.0248 0.0197 0.0234 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5494
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5476
Ophiocordyceps australis map64 (Brazil) OphauB2|2320
Ophiocordyceps camponoti-floridani Ophcf2|07220 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2848
Ophiocordyceps kimflemingae Ophio5|2596
Ophiocordyceps subramaniannii Hirsu2|6600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07220
MLCTRCFRAAITTRHLRPFSTNPPLRSAEPVLSTPDTTPGEAPRKPSPAHRSICTAGTVLTGLNYTKGGRDPVAL
PDEQYPKWLWSCLDIIKKDSDKTDSHADDEFSKSKKLRRAAAKRQKALLAAGPVPVKIPLQHQSINLPGKEGGTV
EENLFAAEKRDELKVAMRKDRKAKIKESNYLKSL*
Coding >Ophcf2|07220
ATGCTGTGCACGCGGTGCTTCCGCGCCGCCATCACAACACGGCACCTCCGACCCTTCTCTACAAACCCACCCCTA
CGATCTGCCGAGCCCGTCCTCTCCACCCCCGACACCACACCAGGCGAAGCCCCGCGGAAGCCATCCCCAGCCCAT
CGGTCAATCTGCACGGCCGGCACCGTCCTCACCGGCTTGAACTACACAAAGGGCGGTCGGGATCCGGTGGCATTG
CCCGACGAGCAGTACCCGAAATGGCTATGGTCATGTCTCGACATTATTAAGAAGGACTCTGACAAGACAGACAGC
CATGCTGACGACGAATTCTCCAAATCCAAAAAACTCCGCCGAGCAGCCGCAAAGCGTCAAAAGGCCCTGCTGGCA
GCAGGCCCCGTCCCGGTCAAGATCCCCTTGCAGCATCAGTCCATCAATCTGCCGGGCAAGGAGGGAGGCACCGTC
GAGGAGAACCTCTTCGCCGCCGAAAAACGCGATGAGCTGAAAGTGGCCATGCGCAAGGATCGCAAGGCCAAGATC
AAGGAGTCTAACTACTTGAAGTCTTTGTGA
Transcript >Ophcf2|07220
ATGCTGTGCACGCGGTGCTTCCGCGCCGCCATCACAACACGGCACCTCCGACCCTTCTCTACAAACCCACCCCTA
CGATCTGCCGAGCCCGTCCTCTCCACCCCCGACACCACACCAGGCGAAGCCCCGCGGAAGCCATCCCCAGCCCAT
CGGTCAATCTGCACGGCCGGCACCGTCCTCACCGGCTTGAACTACACAAAGGGCGGTCGGGATCCGGTGGCATTG
CCCGACGAGCAGTACCCGAAATGGCTATGGTCATGTCTCGACATTATTAAGAAGGACTCTGACAAGACAGACAGC
CATGCTGACGACGAATTCTCCAAATCCAAAAAACTCCGCCGAGCAGCCGCAAAGCGTCAAAAGGCCCTGCTGGCA
GCAGGCCCCGTCCCGGTCAAGATCCCCTTGCAGCATCAGTCCATCAATCTGCCGGGCAAGGAGGGAGGCACCGTC
GAGGAGAACCTCTTCGCCGCCGAAAAACGCGATGAGCTGAAAGTGGCCATGCGCAAGGATCGCAAGGCCAAGATC
AAGGAGTCTAACTACTTGAAGTCTTTGTGA
Gene >Ophcf2|07220
ATGCTGTGCACGCGGTGCTTCCGCGCCGCCATCACAACACGGCACCTCCGACCCTTCTCTACAAACCCACCCCTA
CGATCTGCCGAGCCCGTCCTCTCCACCCCCGACACCACACCAGGCGAAGCCCCGCGGAAGCCATCCCCAGCCCAT
CGGTCAATCTGCACGGCCGGCACCGTCCTCACCGGCTTGAACTACACAAAGGGCGGTCGGGATCCGGTGGCATTG
CCCGACGAGCAGTACCCGAAATGGCTATGGTCATGTCTCGACATTATTAAGAAGGACTCTGACAAGACAGACAGC
CATGCTGACGACGAATTCTGTAAGCAGAACCCTTTCTTCTACCTCCTACCTACCTCCTTCGTGCTGTAAGCTAAC
CTGCTCTTCCTCACCAGCCAAATCCAAAAAACTCCGCCGAGCAGCCGCAAAGCGTCAAAAGGCCCTGCTGGCAGC
AGGCCCCGTCCCGGTCAAGATCCCCTTGCAGCATCAGTCCATCAATCTGCCGGGCAAGGAGGGAGGCACCGTCGA
GGAGAACCTCTTCGCCGCCGAAAAACGCGATGAGCTGAAAGTGGCCATGCGCAAGGATCGCAAGGCCAAGATCAA
GGAGTCTAACTACTTGAAGTCTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail