Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07214
Gene name
Locationscaffold_09:941551..942977
Strand-
Gene length (bp)1426
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00191 Annexin Annexin 3.6E-20 137 201
PF00191 Annexin Annexin 2.2E-13 209 271
PF00191 Annexin Annexin 8.8E-18 295 356
PF00191 Annexin Annexin 3.5E-12 369 434

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005544 calcium-dependent phospholipid binding Yes
GO:0043169 cation binding No
GO:0005543 phospholipid binding No
GO:0043167 ion binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5787 0.6336 0.1163 0.2866 0.1372 0.0057 0.0815 0.4994 0.0189 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4548
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1452
Ophiocordyceps australis map64 (Brazil) OphauB2|2310
Ophiocordyceps camponoti-floridani Ophcf2|07214 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2854
Ophiocordyceps kimflemingae Ophio5|2603
Ophiocordyceps subramaniannii Hirsu2|9511

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07214
MSYQGYGQPPPPPQGYGHYPPPSAGQYPPHGQHPPHQGGYHQPPPGQYSQPPPGQYGQPPPGQYGQPPPGQYGHL
PPSQYGAPPSGHYGAPPPGQYGHPPPGQYGAPPPGQSPQAPRTPPSLGYGAPQIIQWDPQPDVQALRSAMKGFGT
DEKALIRILTTKDPLQMDLIRNTFARSLNRDLVKDLKSETSGWFEKGLVQLARGPLLTDVHYLQEAMAGPGTKEV
VLNDVLLSRSNADLDAIKSAYHHAFHKSLVDAVKGELSMKTQRHFLMVLSASRAEDAAPVIPQQVEDDVTALYKA
TEAKMGTDELLVCDIMSHRNDNQIRAIAHRYQQRFNRDLEKVISSEFSGHMKDALLYQLRHATDKYMHAATLLEE
SMKGMGTKDHLLVSRVVRYHWDRNELANIKGAYQQRYGKTIGSRIKGETSGDYGRLMLACVAE*
Coding >Ophcf2|07214
ATGTCCTACCAAGGATACGGTCAACCGCCACCGCCGCCTCAGGGCTACGGTCACTACCCTCCGCCGTCTGCCGGA
CAGTATCCGCCTCATGGACAGCATCCTCCTCATCAAGGGGGCTATCATCAACCTCCGCCCGGTCAGTACAGCCAA
CCTCCTCCCGGTCAATACGGTCAACCTCCACCTGGTCAGTACGGTCAACCTCCGCCCGGTCAATACGGCCATCTC
CCGCCAAGCCAGTATGGCGCCCCTCCTTCCGGACATTACGGCGCGCCTCCTCCCGGCCAGTACGGGCATCCGCCC
CCCGGTCAGTATGGCGCACCGCCCCCCGGTCAGTCCCCTCAGGCTCCGCGGACCCCCCCGTCGCTGGGTTACGGC
GCGCCGCAGATCATTCAGTGGGATCCGCAACCGGATGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACC
GACGAAAAGGCGCTCATCCGTATCCTGACGACCAAGGACCCTTTGCAGATGGACCTCATACGCAATACATTTGCT
CGCTCCCTCAACCGCGACCTCGTTAAGGATCTCAAGAGCGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAG
CTCGCCCGCGGTCCCTTGTTGACGGATGTGCACTATCTCCAAGAGGCCATGGCAGGGCCTGGCACCAAGGAGGTT
GTCCTGAATGACGTTTTACTTTCTCGATCCAATGCCGATCTCGACGCCATCAAGAGTGCCTACCATCACGCTTTC
CACAAGTCACTCGTCGACGCCGTCAAGGGTGAATTGTCGATGAAGACGCAGAGGCACTTCCTCATGGTCCTGTCG
GCCAGCCGAGCCGAGGACGCTGCGCCGGTGATCCCACAGCAGGTCGAGGACGACGTGACGGCTTTGTACAAGGCG
ACGGAAGCAAAGATGGGCACCGATGAGCTCCTCGTATGCGACATCATGTCGCACCGAAACGATAATCAGATCCGT
GCCATTGCCCATAGGTACCAGCAGAGGTTCAACCGCGATCTGGAAAAGGTCATTTCCTCGGAATTCTCGGGGCAC
ATGAAAGATGCCCTCCTGTATCAGCTACGACATGCGACGGACAAGTACATGCACGCCGCGACGCTTCTCGAAGAG
AGCATGAAAGGCATGGGAACTAAGGATCATCTGCTCGTCTCGCGTGTCGTCCGCTATCATTGGGACAGAAACGAA
CTGGCCAATATCAAGGGGGCCTATCAGCAGAGATACGGCAAGACGATCGGCTCTCGCATCAAGGGCGAGACGTCT
GGTGACTATGGCAGGCTGATGTTGGCGTGTGTCGCTGAATAG
Transcript >Ophcf2|07214
ATGTCCTACCAAGGATACGGTCAACCGCCACCGCCGCCTCAGGGCTACGGTCACTACCCTCCGCCGTCTGCCGGA
CAGTATCCGCCTCATGGACAGCATCCTCCTCATCAAGGGGGCTATCATCAACCTCCGCCCGGTCAGTACAGCCAA
CCTCCTCCCGGTCAATACGGTCAACCTCCACCTGGTCAGTACGGTCAACCTCCGCCCGGTCAATACGGCCATCTC
CCGCCAAGCCAGTATGGCGCCCCTCCTTCCGGACATTACGGCGCGCCTCCTCCCGGCCAGTACGGGCATCCGCCC
CCCGGTCAGTATGGCGCACCGCCCCCCGGTCAGTCCCCTCAGGCTCCGCGGACCCCCCCGTCGCTGGGTTACGGC
GCGCCGCAGATCATTCAGTGGGATCCGCAACCGGATGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACC
GACGAAAAGGCGCTCATCCGTATCCTGACGACCAAGGACCCTTTGCAGATGGACCTCATACGCAATACATTTGCT
CGCTCCCTCAACCGCGACCTCGTTAAGGATCTCAAGAGCGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAG
CTCGCCCGCGGTCCCTTGTTGACGGATGTGCACTATCTCCAAGAGGCCATGGCAGGGCCTGGCACCAAGGAGGTT
GTCCTGAATGACGTTTTACTTTCTCGATCCAATGCCGATCTCGACGCCATCAAGAGTGCCTACCATCACGCTTTC
CACAAGTCACTCGTCGACGCCGTCAAGGGTGAATTGTCGATGAAGACGCAGAGGCACTTCCTCATGGTCCTGTCG
GCCAGCCGAGCCGAGGACGCTGCGCCGGTGATCCCACAGCAGGTCGAGGACGACGTGACGGCTTTGTACAAGGCG
ACGGAAGCAAAGATGGGCACCGATGAGCTCCTCGTATGCGACATCATGTCGCACCGAAACGATAATCAGATCCGT
GCCATTGCCCATAGGTACCAGCAGAGGTTCAACCGCGATCTGGAAAAGGTCATTTCCTCGGAATTCTCGGGGCAC
ATGAAAGATGCCCTCCTGTATCAGCTACGACATGCGACGGACAAGTACATGCACGCCGCGACGCTTCTCGAAGAG
AGCATGAAAGGCATGGGAACTAAGGATCATCTGCTCGTCTCGCGTGTCGTCCGCTATCATTGGGACAGAAACGAA
CTGGCCAATATCAAGGGGGCCTATCAGCAGAGATACGGCAAGACGATCGGCTCTCGCATCAAGGGCGAGACGTCT
GGTGACTATGGCAGGCTGATGTTGGCGTGTGTCGCTGAATAG
Gene >Ophcf2|07214
ATGTCCTACCAAGGATACGGTCGTCAGTTGCCCTTTGCTTCCGTCGTTATGACTGACTCCCGATCTGACTCGTAC
CCGCAGAACCGCCACCGCCGCCTCAGGGCTACGGTCACTACCCTCCGCCGTCTGCCGGACAGTATCCGCCTCATG
GACAGCATCCTCCTCATCAAGGGGGCTATCATCAACCTCCGCCCGGTCAGTACAGCCAACCTCCTCCCGGTCAAT
ACGGTCAACCTCCACCTGGTCAGTACGGTCAACCTCCGCCCGGTCAATACGGCCATCTCCCGCCAAGCCAGTATG
GCGCCCCTCCTTCCGGACATTACGGCGCGCCTCCTCCCGGCCAGTACGGGCATCCGCCCCCCGGTCAGTATGGCG
CACCGCCCCCCGGTCAGTCCCCTCAGGCTCCGCGGACCCCCCCGTCGCTGGGTTACGGCGCGCCGCAGATCATTC
AGTGGGATCCGCAACCGGATGTTCAGGCCCTGCGGAGCGCCATGAAAGGCTTCGGCACCGACGAAAAGGCGCTCA
TCCGTATCCTGACGACCAAGGACCCTTTGCAGATGGACCTCATACGCAATACATTTGCTCGCTCCCTCAACCGCG
ACCTCGTTAAGGATCTCAAGAGCGAGACGAGCGGCTGGTTCGAAAAGGGCTTGGTGCAGCTCGCCCGCGGTCCCT
TGTTGACGGATGTGCACTATCTCCAAGAGGCCATGGCAGGGCCTGGCACCAAGGAGGTTGTCCTGAATGACGTTT
TACTTTCTCGATCCAATGCCGATCTCGACGCCATCAAGAGTGCCTACCATCACGCTTTCCACAAGTCACTCGTCG
ACGCCGTCAAGGGTGAATTGTCGATGAAGACGCAGAGGCACTTCCTCATGGTCCTGTCGGCCAGCCGAGCCGAGG
ACGCTGCGCCGGTGATCCCACAGCAGGTCGAGGACGACGTGACGGCTTTGTACAAGGCGACGGAAGCAAAGATGG
GCACCGATGAGCTCCTCGTATGCGACATCATGTCGCACCGAAACGATAATCAGATCCGTGCCATTGCCCATAGGT
ACCAGCAGAGGTTCAACCGCGATCTGGAAAAGGTCATTTCCTCGGTAAGAAGCCACCCTGAAACATGTTGAAAGC
GCGAGCTGACGCCGTTTAGGAATTCTCGGGGCACATGAAAGATGCCCTCCTGTATCAGCTACGACATGCGACGGA
CAAGTACATGCACGCCGCGACGCTTCTCGAAGAGAGCATGAAAGGCATGGGAACTAAGGATCATCTGCTCGTCTC
GCGTGTCGTCCGCTATCATTGGGACAGAAACGAACTGGCCAATATCAAGGGGGCCTATCAGCAGAGATACGGCAA
GACGATCGGCTCTCGCATCAAGGGCGAGACGTCTGGTGACTATGGCAGGCTGATGTTGGCGTGTGTCGCTGAATA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail