Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07210
Gene name
Locationscaffold_09:931123..932942
Strand-
Gene length (bp)1819
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02541 Ppx-GppA Ppx/GppA phosphatase family 2.1E-20 48 361

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6038 0.5513 0.0308 0.1414 0.1624 0.0205 0.0729 0.0597 0.0602 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1864
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1988
Ophiocordyceps australis map64 (Brazil) OphauB2|2304
Ophiocordyceps camponoti-floridani Ophcf2|07210 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6703
Ophiocordyceps kimflemingae Ophio5|2481
Ophiocordyceps subramaniannii Hirsu2|1894

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07210
MSLVINHHFSQQLPEWRPNDDNFVYPVIDVGSNGIRFSITDLAPPKARLLRPLYSERADISILDALKPSGDGALE
IPPDTIVNVSTAIARFHRIARLFGAPSNHIIVLATEGVRRASNASKLLEAITAVDHDMFIRVIDPAVETLFGAVM
GSRSGFVNIPRGGLFLDLGGGSVQMTWVDTKAPDYGISAATAGVSLPYGAARLIKILEDESHEVRTAALDDLRSG
FSRIYAELCLKFPALEAIRAANNDGHDSTVDVYLTGGGFRGYGSMLMFYDDSIEPYPISSVNTYSAPGSLFARAA
EMERVNKKHDGHIFGLSKRRRSQFPAIVAVVEALVAAVPNIGRATFCGGSNRQGVLMMMLPPEMRESDPLRVLSD
VSPSEEAFFDAAVRLLTAALPSDLVGSDMPTVLNLGLGPLLIRESWLRAGYSADTNSVFALHDSVVRDSDCPGLT
HLARAVLGLSVCARWGGGFGPAEEPLFRGLCAVADSHAEDASFWALYVGAVAAIIASVFPVMPKEQDLLTSAIRL
ESKIVTGGHKGKKDKVTLTIGLDSAYAKDTEAVVDKFESTMSKKGNKSAPKVVAQVVPFS*
Coding >Ophcf2|07210
ATGTCTCTCGTCATCAACCATCATTTCTCTCAGCAGCTGCCTGAATGGCGCCCCAACGACGACAACTTCGTCTAT
CCCGTCATCGACGTGGGTTCCAACGGCATTCGCTTCTCCATCACTGATCTTGCTCCTCCGAAGGCTCGTCTCTTG
CGTCCCCTCTACTCTGAGCGCGCCGACATCTCCATTCTCGATGCTTTGAAGCCCTCGGGCGACGGCGCCCTTGAG
ATTCCCCCCGATACCATCGTCAACGTCTCCACGGCTATCGCTCGCTTTCATCGCATCGCGCGTCTTTTCGGTGCG
CCGTCTAACCACATCATCGTCCTCGCCACTGAAGGGGTGCGCCGTGCTTCCAATGCATCCAAGCTGCTGGAAGCA
ATCACTGCCGTTGACCACGACATGTTCATCCGTGTAATCGATCCAGCCGTCGAGACCCTCTTCGGCGCCGTCATG
GGCTCCCGTAGCGGCTTCGTCAACATCCCTCGCGGCGGTCTCTTCCTCGACCTCGGCGGCGGGAGCGTTCAGATG
ACATGGGTCGATACCAAGGCTCCGGACTATGGCATTTCTGCTGCCACGGCCGGCGTGAGTCTTCCTTATGGCGCT
GCCCGCTTGATCAAGATACTGGAAGACGAGTCACACGAGGTTCGGACGGCTGCTCTCGATGACCTGCGCAGTGGC
TTCAGTCGCATCTACGCCGAACTATGCCTCAAGTTTCCCGCCCTCGAGGCTATTCGAGCCGCCAACAATGACGGC
CACGACAGTACTGTCGACGTATATCTCACAGGCGGTGGGTTCCGTGGCTACGGCAGCATGCTCATGTTCTACGAC
GATTCCATCGAGCCCTATCCCATCTCGTCGGTAAACACCTACTCCGCTCCGGGCTCCCTGTTCGCCCGCGCCGCC
GAGATGGAACGGGTCAACAAGAAACACGATGGTCACATCTTCGGCCTGTCCAAGAGGCGTCGCAGCCAATTCCCG
GCCATCGTCGCCGTTGTCGAGGCTCTGGTGGCCGCCGTGCCAAACATCGGACGAGCCACCTTTTGCGGCGGCTCC
AACCGTCAAGGCGTCCTGATGATGATGCTTCCACCAGAGATGCGCGAAAGCGATCCGCTCCGCGTCCTCTCTGAC
GTTTCTCCTTCCGAGGAGGCCTTTTTCGATGCCGCCGTGCGCCTCCTGACCGCCGCCCTACCATCGGACCTCGTC
GGCTCCGACATGCCGACCGTCTTGAACCTGGGACTCGGGCCGCTGCTCATCCGCGAGAGTTGGCTCCGTGCCGGC
TACAGCGCCGACACCAATTCCGTCTTCGCCCTTCACGACTCCGTCGTCCGTGATTCTGACTGCCCCGGCTTGACT
CACCTCGCCCGCGCTGTTCTCGGTCTGAGCGTCTGCGCCAGATGGGGCGGTGGCTTCGGTCCGGCAGAAGAGCCC
CTATTCCGCGGATTGTGTGCCGTCGCCGACAGTCACGCCGAGGACGCGTCCTTCTGGGCCCTTTACGTCGGCGCG
GTGGCTGCCATCATAGCTTCCGTGTTTCCCGTCATGCCCAAGGAGCAGGATCTCCTTACGAGTGCCATCCGACTT
GAATCGAAAATCGTCACGGGGGGCCACAAGGGCAAGAAAGATAAAGTCACATTGACAATCGGCTTAGATTCCGCC
TACGCCAAAGACACAGAGGCCGTAGTCGACAAATTCGAGTCGACCATGAGTAAGAAAGGAAATAAATCAGCCCCC
AAAGTAGTCGCTCAAGTCGTCCCTTTTTCATGA
Transcript >Ophcf2|07210
ATGTCTCTCGTCATCAACCATCATTTCTCTCAGCAGCTGCCTGAATGGCGCCCCAACGACGACAACTTCGTCTAT
CCCGTCATCGACGTGGGTTCCAACGGCATTCGCTTCTCCATCACTGATCTTGCTCCTCCGAAGGCTCGTCTCTTG
CGTCCCCTCTACTCTGAGCGCGCCGACATCTCCATTCTCGATGCTTTGAAGCCCTCGGGCGACGGCGCCCTTGAG
ATTCCCCCCGATACCATCGTCAACGTCTCCACGGCTATCGCTCGCTTTCATCGCATCGCGCGTCTTTTCGGTGCG
CCGTCTAACCACATCATCGTCCTCGCCACTGAAGGGGTGCGCCGTGCTTCCAATGCATCCAAGCTGCTGGAAGCA
ATCACTGCCGTTGACCACGACATGTTCATCCGTGTAATCGATCCAGCCGTCGAGACCCTCTTCGGCGCCGTCATG
GGCTCCCGTAGCGGCTTCGTCAACATCCCTCGCGGCGGTCTCTTCCTCGACCTCGGCGGCGGGAGCGTTCAGATG
ACATGGGTCGATACCAAGGCTCCGGACTATGGCATTTCTGCTGCCACGGCCGGCGTGAGTCTTCCTTATGGCGCT
GCCCGCTTGATCAAGATACTGGAAGACGAGTCACACGAGGTTCGGACGGCTGCTCTCGATGACCTGCGCAGTGGC
TTCAGTCGCATCTACGCCGAACTATGCCTCAAGTTTCCCGCCCTCGAGGCTATTCGAGCCGCCAACAATGACGGC
CACGACAGTACTGTCGACGTATATCTCACAGGCGGTGGGTTCCGTGGCTACGGCAGCATGCTCATGTTCTACGAC
GATTCCATCGAGCCCTATCCCATCTCGTCGGTAAACACCTACTCCGCTCCGGGCTCCCTGTTCGCCCGCGCCGCC
GAGATGGAACGGGTCAACAAGAAACACGATGGTCACATCTTCGGCCTGTCCAAGAGGCGTCGCAGCCAATTCCCG
GCCATCGTCGCCGTTGTCGAGGCTCTGGTGGCCGCCGTGCCAAACATCGGACGAGCCACCTTTTGCGGCGGCTCC
AACCGTCAAGGCGTCCTGATGATGATGCTTCCACCAGAGATGCGCGAAAGCGATCCGCTCCGCGTCCTCTCTGAC
GTTTCTCCTTCCGAGGAGGCCTTTTTCGATGCCGCCGTGCGCCTCCTGACCGCCGCCCTACCATCGGACCTCGTC
GGCTCCGACATGCCGACCGTCTTGAACCTGGGACTCGGGCCGCTGCTCATCCGCGAGAGTTGGCTCCGTGCCGGC
TACAGCGCCGACACCAATTCCGTCTTCGCCCTTCACGACTCCGTCGTCCGTGATTCTGACTGCCCCGGCTTGACT
CACCTCGCCCGCGCTGTTCTCGGTCTGAGCGTCTGCGCCAGATGGGGCGGTGGCTTCGGTCCGGCAGAAGAGCCC
CTATTCCGCGGATTGTGTGCCGTCGCCGACAGTCACGCCGAGGACGCGTCCTTCTGGGCCCTTTACGTCGGCGCG
GTGGCTGCCATCATAGCTTCCGTGTTTCCCGTCATGCCCAAGGAGCAGGATCTCCTTACGAGTGCCATCCGACTT
GAATCGAAAATCGTCACGGGGGGCCACAAGGGCAAGAAAGATAAAGTCACATTGACAATCGGCTTAGATTCCGCC
TACGCCAAAGACACAGAGGCCGTAGTCGACAAATTCGAGTCGACCATGAGTAAGAAAGGAAATAAATCAGCCCCC
AAAGTAGTCGCTCAAGTCGTCCCTTTTTCATGA
Gene >Ophcf2|07210
ATGTCTCTCGTCATCAACCATCATTTCTCTCAGCAGCTGCCTGAATGGCGCCCCAACGACGACAACTTCGTCTAT
CCCGTCATCGACGTGGGTTCCAACGGCATTCGCTTCTCCATCACTGATCTTGCTCCTCCGAAGGCTCGTCTCTTG
CGTCCCCTCTACTCTGAGCGCGCCGACATCTCCATTCTCGATGCTTTGAAGCCCTCGGGCGACGGCGCCCTTGAG
ATTCCCCCCGATACCATCGTCAACGTCTCCACGGCTATCGCTCGCTTTCATCGCATCGCGCGTCTTTTCGGTGCG
CCGTCTAACCACATCATCGTCCTCGCCACTGAAGGGGTGCGCCGTGCTTCCAATGCATCCAAGCTGCTGGAAGCA
ATCACTGCCGTTGACCACGACATGTTCATCCGTGTAATCGATCCAGCCGTCGAGACCCTCTTCGGCGCCGTCATG
GGCTCCCGTAGCGGCTTCGTCAACATCCCTCGCGGCGGTCTCTTCCTCGACCTCGGCGGCGGGAGCGTTCAGATG
ACATGGGTCGATACCAAGGCTCCGGACTATGGCATTTCTGCTGCCACGGCCGGCGTGAGTCTTCCTTATGGCGCT
GCCCGCTTGATCAAGATACTGGAAGACGAGTCACACGAGGTTCGGACGGCTGCTCTCGATGACCTGCGCAGTGGC
TTCAGTCGCATCTACGCCGAACTATGCCTCAAGTTTCCCGCCCTCGAGGCTATTCGAGCCGCCAACAATGACGGC
CACGACAGTACTGTCGACGTATATCTCACAGGCGGTGGGTTCCGTGGCTACGGCAGCATGCTCATGTTCTACGAC
GATTCCATCGAGCCCTATCCCATCTCGTCGGTAAACACCTACTCCGCTCCGGGCTCCCTGTTCGCCCGCGCCGCC
GAGATGGAACGGGTCAACAAGAAACACGATGGTCACATCTTCGGCCTGTCCAAGAGGCGTCGCAGCCAATTCCCG
GCCATCGTCGCCGTTGTCGAGGCTCTGGTGGCCGCCGTGCCAAACATCGGACGAGCCACCTTTTGCGGCGGCTCC
AACCGTCAAGGCGTCCTGATGATGATGCTTCCACCAGAGATGCGCGAAAGCGATCCGCTCCGCGTCCTCTCTGAC
GTTTCTCCTTCCGAGGAGGCCTTTTTCGATGCCGCCGTGCGCCTCCTGACCGCCGCCCTACCATCGGACCTCGTC
GGCTCCGACATGCCGACCGTCTTGAACCTGGGACTCGGGCCGCTGCTCATCCGCGAGAGTTGGCTCCGTGCCGGC
TACAGCGCCGACACCAATTCCGTCTTCGCCCTTCACGACTCCGTCGTCCGTGATTCTGACTGCCCCGGCTTGACT
CACCTCGCCCGCGCTGTTCTCGGTCTGAGCGTCTGCGCCAGATGGGGCGGTGGCTTCGGTCCGGCAGAAGAGCCC
CTATTCCGCGGATTGTGTGCCGTCGCCGACAGTCACGCCGAGGACGCGTCCTTCTGGGCCCTTTACGTCGGCGCG
GTGGCTGCCATCATAGCTTCCGTGTTTCCCGTCATGCCCAAGGAGCAGGATCTCCTTACGAGTGCCATCCGGTAA
CGTCTCTCACTGCTGGCGAGCTTGTCTCCCGATTCGACTAACACACATGCCTCTCAGACTTGAATCGAAAATCGT
CACGGGGGGCCACAAGGGCAAGAAAGATAAAGTCACATTGACAATCGGCTTAGATTCCGCCTACGCCAAAGACAC
AGAGGCCGTAGTCGACAAATTCGAGTCGACCATGAGTAAGAAAGGAAATAAATCAGCCCCCAAAGTAGTCGCTCA
AGTCGTCCCTTTTTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail