Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07203
Gene name
Locationscaffold_09:909516..911979
Strand-
Gene length (bp)2463
Transcript length (bp)2463
Coding sequence length (bp)2463
Protein length (aa) 821

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03215 Rad17 Rad17 P-loop domain 2.6E-24 173 349

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1301 0.964 0.1803 0.012 0.1005 0.0143 0.0106 0.0152 0.0168 0.089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3467
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5967
Ophiocordyceps australis map64 (Brazil) OphauB2|2297
Ophiocordyceps camponoti-floridani Ophcf2|07203 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4757
Ophiocordyceps kimflemingae Ophio5|8165
Ophiocordyceps subramaniannii Hirsu2|6603

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07203
MAPPAKRRRRNPVEDSDGEAEQPRATLANYLISSPTRKEPSSPSKNVTAQKRPRRVATQSNGVGLSPKKAAGNGR
SDEKPKTADLKTLFSKQVQRTTRSKTSANTNTPMNDIISDPISEEDEISDLKASSSSLVGQHARKRLKNGSGAGA
VQVPSASRRFLKPTKPATVASVDDDDLRPWSERFGPRNLDELAVHKRKVSDVRRWLEAVTAGRIRQRLLVLKGAA
GSGKTTTVRLLAQDMGLELLEWKNPTGSRDMLSPSASAQFDEFLGRGGKFGMLDVEAPGTSSSSGVAAQDQSKRI
MLVEEFPNTFSRTSSTLASFRRSIIGYLDAAARPKSQAVNPMIVVISETLLTTTSATADSLTAHRLLGPEILRHP
GAVVMEFNAIAPTFLAKAMELIVQKEARKSGRRKTPGPMVLNRLGEIGDIRSAISALEFLCLKGDYEADWGAKVA
FTKQKKGVRTAIGLTQGEAETLEAITQREASLGIFHAVGKVVYNKRDEAPPADDNVETLPAFIADFARPNRSQVP
VDSLIDEIGTDTQTFVSALHENYILSCESTEPMDTSTSMDYVNECIEYLSLSDLLGPSRDVFFGGFGRDSSSSQQ
LRQDEMTFQVAVRGLLFSLPHPVKRKPTGTLKGSDAFKMFYPTSIKLWKSKEEIEGLVDVWSSRLLRGEEQLGSK
NSTDGANAFRKPTTTSWTDRAQREAAAANSEVSEARPPMWLGSTARREMVQDRLPYMAHMARARRSGTRDLEKMV
AMRGTWKPTDEDGDGGGDQELDGSAGEAWATDRPSEEASPQRRRAGVRAGEVSGLMTQKLVLSDDDIEDD*
Coding >Ophcf2|07203
ATGGCCCCGCCAGCGAAGCGCCGGAGGCGAAATCCGGTCGAGGATTCTGATGGCGAGGCCGAACAGCCGCGGGCC
ACGCTGGCCAACTACTTGATATCGTCCCCGACCAGGAAAGAACCGTCGAGTCCCTCCAAGAATGTCACCGCGCAG
AAAAGACCTCGCAGAGTTGCGACGCAGAGTAATGGAGTCGGACTGAGCCCTAAGAAGGCAGCAGGCAACGGACGG
TCAGACGAGAAGCCCAAGACGGCCGATCTCAAAACGCTCTTCTCCAAGCAGGTCCAGAGAACGACGAGGTCGAAG
ACAAGCGCAAATACGAACACGCCCATGAACGACATCATCAGCGATCCCATCTCCGAGGAGGACGAGATCTCGGAT
CTCAAGGCCAGCTCCTCCAGTCTGGTCGGGCAGCATGCAAGGAAGCGCTTGAAGAACGGCTCCGGCGCCGGCGCC
GTCCAAGTCCCGAGCGCAAGCCGGAGATTTCTCAAGCCGACGAAGCCGGCTACAGTCGCCTCAGTCGACGACGAC
GACCTGCGGCCCTGGTCGGAAAGATTTGGACCCAGAAACCTGGATGAGCTGGCGGTTCACAAGAGAAAGGTTTCG
GACGTCCGCAGGTGGCTCGAGGCCGTCACTGCTGGTCGAATACGACAACGGTTGCTGGTGCTCAAGGGCGCTGCG
GGCTCTGGCAAGACGACGACGGTACGGCTGCTGGCGCAAGACATGGGGCTGGAGCTCTTGGAGTGGAAGAATCCG
ACAGGTTCCCGTGATATGCTGTCGCCGTCGGCATCGGCACAGTTTGACGAGTTCCTGGGCCGAGGGGGGAAATTT
GGTATGCTCGACGTCGAGGCGCCTGGCACATCTAGCAGTTCAGGGGTCGCGGCTCAAGACCAGTCCAAGAGAATC
ATGCTCGTCGAGGAATTTCCAAACACTTTCTCTCGAACGTCGTCAACTCTGGCGTCGTTCAGAAGGTCCATCATT
GGCTATCTAGACGCGGCTGCACGACCCAAGTCTCAGGCAGTCAACCCTATGATTGTCGTCATTTCCGAGACTCTC
CTGACGACGACTTCGGCAACGGCAGACAGTCTGACGGCCCACCGGCTTCTCGGGCCCGAGATTCTGCGTCACCCA
GGCGCGGTGGTGATGGAATTCAACGCCATCGCGCCCACTTTCCTGGCCAAGGCCATGGAGCTCATCGTGCAGAAA
GAGGCGCGCAAGTCGGGGCGAAGGAAGACACCGGGGCCGATGGTGCTGAATCGGCTTGGCGAGATTGGCGACATC
CGCAGCGCCATCTCGGCGCTCGAGTTCCTGTGCCTCAAAGGCGACTACGAGGCCGACTGGGGAGCCAAGGTGGCG
TTTACGAAGCAGAAGAAGGGCGTCCGAACAGCCATAGGCCTGACGCAGGGCGAGGCAGAGACTCTCGAGGCCATT
ACGCAGCGCGAGGCCAGTCTCGGCATATTTCACGCCGTTGGCAAAGTCGTGTACAATAAGCGAGACGAGGCGCCT
CCAGCAGACGACAATGTCGAGACGCTGCCGGCCTTTATCGCCGACTTTGCGCGGCCGAACAGATCGCAAGTTCCC
GTCGACAGCCTCATCGACGAGATCGGGACGGACACGCAGACGTTTGTATCGGCCCTGCACGAGAATTACATCCTG
TCTTGCGAAAGCACGGAGCCGATGGACACGTCGACATCGATGGACTACGTCAACGAGTGCATCGAGTACCTCTCC
CTCAGCGACCTGCTCGGACCGTCTCGGGACGTCTTCTTTGGCGGGTTCGGGAGGGATAGCAGCAGCAGTCAGCAA
CTGCGACAAGATGAGATGACGTTTCAGGTGGCCGTTAGAGGCCTGCTGTTCTCGCTGCCGCACCCGGTCAAGCGG
AAACCGACGGGGACGCTCAAGGGCAGTGACGCCTTCAAGATGTTTTACCCGACGAGCATCAAGCTGTGGAAGTCA
AAGGAGGAGATTGAAGGCCTCGTGGACGTGTGGTCATCACGACTACTCAGGGGCGAGGAGCAGCTGGGAAGCAAG
AACTCGACGGACGGCGCCAACGCATTCCGCAAACCGACGACGACATCGTGGACGGATCGGGCGCAACGAGAGGCT
GCGGCGGCGAACAGCGAGGTATCAGAGGCGCGACCGCCCATGTGGCTCGGCAGCACGGCACGACGGGAGATGGTT
CAAGATCGGCTCCCGTACATGGCGCACATGGCACGAGCAAGGAGAAGCGGCACCCGCGATCTGGAGAAGATGGTA
GCTATGCGGGGAACTTGGAAGCCAACAGACGAAGACGGAGACGGAGGCGGAGACCAAGAGCTGGACGGGTCGGCG
GGCGAGGCGTGGGCTACAGACAGGCCATCAGAGGAAGCCAGTCCGCAGAGACGACGTGCTGGGGTGAGGGCGGGA
GAGGTTTCGGGGCTGATGACGCAGAAACTTGTGCTGAGCGACGATGATATTGAGGACGACTAG
Transcript >Ophcf2|07203
ATGGCCCCGCCAGCGAAGCGCCGGAGGCGAAATCCGGTCGAGGATTCTGATGGCGAGGCCGAACAGCCGCGGGCC
ACGCTGGCCAACTACTTGATATCGTCCCCGACCAGGAAAGAACCGTCGAGTCCCTCCAAGAATGTCACCGCGCAG
AAAAGACCTCGCAGAGTTGCGACGCAGAGTAATGGAGTCGGACTGAGCCCTAAGAAGGCAGCAGGCAACGGACGG
TCAGACGAGAAGCCCAAGACGGCCGATCTCAAAACGCTCTTCTCCAAGCAGGTCCAGAGAACGACGAGGTCGAAG
ACAAGCGCAAATACGAACACGCCCATGAACGACATCATCAGCGATCCCATCTCCGAGGAGGACGAGATCTCGGAT
CTCAAGGCCAGCTCCTCCAGTCTGGTCGGGCAGCATGCAAGGAAGCGCTTGAAGAACGGCTCCGGCGCCGGCGCC
GTCCAAGTCCCGAGCGCAAGCCGGAGATTTCTCAAGCCGACGAAGCCGGCTACAGTCGCCTCAGTCGACGACGAC
GACCTGCGGCCCTGGTCGGAAAGATTTGGACCCAGAAACCTGGATGAGCTGGCGGTTCACAAGAGAAAGGTTTCG
GACGTCCGCAGGTGGCTCGAGGCCGTCACTGCTGGTCGAATACGACAACGGTTGCTGGTGCTCAAGGGCGCTGCG
GGCTCTGGCAAGACGACGACGGTACGGCTGCTGGCGCAAGACATGGGGCTGGAGCTCTTGGAGTGGAAGAATCCG
ACAGGTTCCCGTGATATGCTGTCGCCGTCGGCATCGGCACAGTTTGACGAGTTCCTGGGCCGAGGGGGGAAATTT
GGTATGCTCGACGTCGAGGCGCCTGGCACATCTAGCAGTTCAGGGGTCGCGGCTCAAGACCAGTCCAAGAGAATC
ATGCTCGTCGAGGAATTTCCAAACACTTTCTCTCGAACGTCGTCAACTCTGGCGTCGTTCAGAAGGTCCATCATT
GGCTATCTAGACGCGGCTGCACGACCCAAGTCTCAGGCAGTCAACCCTATGATTGTCGTCATTTCCGAGACTCTC
CTGACGACGACTTCGGCAACGGCAGACAGTCTGACGGCCCACCGGCTTCTCGGGCCCGAGATTCTGCGTCACCCA
GGCGCGGTGGTGATGGAATTCAACGCCATCGCGCCCACTTTCCTGGCCAAGGCCATGGAGCTCATCGTGCAGAAA
GAGGCGCGCAAGTCGGGGCGAAGGAAGACACCGGGGCCGATGGTGCTGAATCGGCTTGGCGAGATTGGCGACATC
CGCAGCGCCATCTCGGCGCTCGAGTTCCTGTGCCTCAAAGGCGACTACGAGGCCGACTGGGGAGCCAAGGTGGCG
TTTACGAAGCAGAAGAAGGGCGTCCGAACAGCCATAGGCCTGACGCAGGGCGAGGCAGAGACTCTCGAGGCCATT
ACGCAGCGCGAGGCCAGTCTCGGCATATTTCACGCCGTTGGCAAAGTCGTGTACAATAAGCGAGACGAGGCGCCT
CCAGCAGACGACAATGTCGAGACGCTGCCGGCCTTTATCGCCGACTTTGCGCGGCCGAACAGATCGCAAGTTCCC
GTCGACAGCCTCATCGACGAGATCGGGACGGACACGCAGACGTTTGTATCGGCCCTGCACGAGAATTACATCCTG
TCTTGCGAAAGCACGGAGCCGATGGACACGTCGACATCGATGGACTACGTCAACGAGTGCATCGAGTACCTCTCC
CTCAGCGACCTGCTCGGACCGTCTCGGGACGTCTTCTTTGGCGGGTTCGGGAGGGATAGCAGCAGCAGTCAGCAA
CTGCGACAAGATGAGATGACGTTTCAGGTGGCCGTTAGAGGCCTGCTGTTCTCGCTGCCGCACCCGGTCAAGCGG
AAACCGACGGGGACGCTCAAGGGCAGTGACGCCTTCAAGATGTTTTACCCGACGAGCATCAAGCTGTGGAAGTCA
AAGGAGGAGATTGAAGGCCTCGTGGACGTGTGGTCATCACGACTACTCAGGGGCGAGGAGCAGCTGGGAAGCAAG
AACTCGACGGACGGCGCCAACGCATTCCGCAAACCGACGACGACATCGTGGACGGATCGGGCGCAACGAGAGGCT
GCGGCGGCGAACAGCGAGGTATCAGAGGCGCGACCGCCCATGTGGCTCGGCAGCACGGCACGACGGGAGATGGTT
CAAGATCGGCTCCCGTACATGGCGCACATGGCACGAGCAAGGAGAAGCGGCACCCGCGATCTGGAGAAGATGGTA
GCTATGCGGGGAACTTGGAAGCCAACAGACGAAGACGGAGACGGAGGCGGAGACCAAGAGCTGGACGGGTCGGCG
GGCGAGGCGTGGGCTACAGACAGGCCATCAGAGGAAGCCAGTCCGCAGAGACGACGTGCTGGGGTGAGGGCGGGA
GAGGTTTCGGGGCTGATGACGCAGAAACTTGTGCTGAGCGACGATGATATTGAGGACGACTAG
Gene >Ophcf2|07203
ATGGCCCCGCCAGCGAAGCGCCGGAGGCGAAATCCGGTCGAGGATTCTGATGGCGAGGCCGAACAGCCGCGGGCC
ACGCTGGCCAACTACTTGATATCGTCCCCGACCAGGAAAGAACCGTCGAGTCCCTCCAAGAATGTCACCGCGCAG
AAAAGACCTCGCAGAGTTGCGACGCAGAGTAATGGAGTCGGACTGAGCCCTAAGAAGGCAGCAGGCAACGGACGG
TCAGACGAGAAGCCCAAGACGGCCGATCTCAAAACGCTCTTCTCCAAGCAGGTCCAGAGAACGACGAGGTCGAAG
ACAAGCGCAAATACGAACACGCCCATGAACGACATCATCAGCGATCCCATCTCCGAGGAGGACGAGATCTCGGAT
CTCAAGGCCAGCTCCTCCAGTCTGGTCGGGCAGCATGCAAGGAAGCGCTTGAAGAACGGCTCCGGCGCCGGCGCC
GTCCAAGTCCCGAGCGCAAGCCGGAGATTTCTCAAGCCGACGAAGCCGGCTACAGTCGCCTCAGTCGACGACGAC
GACCTGCGGCCCTGGTCGGAAAGATTTGGACCCAGAAACCTGGATGAGCTGGCGGTTCACAAGAGAAAGGTTTCG
GACGTCCGCAGGTGGCTCGAGGCCGTCACTGCTGGTCGAATACGACAACGGTTGCTGGTGCTCAAGGGCGCTGCG
GGCTCTGGCAAGACGACGACGGTACGGCTGCTGGCGCAAGACATGGGGCTGGAGCTCTTGGAGTGGAAGAATCCG
ACAGGTTCCCGTGATATGCTGTCGCCGTCGGCATCGGCACAGTTTGACGAGTTCCTGGGCCGAGGGGGGAAATTT
GGTATGCTCGACGTCGAGGCGCCTGGCACATCTAGCAGTTCAGGGGTCGCGGCTCAAGACCAGTCCAAGAGAATC
ATGCTCGTCGAGGAATTTCCAAACACTTTCTCTCGAACGTCGTCAACTCTGGCGTCGTTCAGAAGGTCCATCATT
GGCTATCTAGACGCGGCTGCACGACCCAAGTCTCAGGCAGTCAACCCTATGATTGTCGTCATTTCCGAGACTCTC
CTGACGACGACTTCGGCAACGGCAGACAGTCTGACGGCCCACCGGCTTCTCGGGCCCGAGATTCTGCGTCACCCA
GGCGCGGTGGTGATGGAATTCAACGCCATCGCGCCCACTTTCCTGGCCAAGGCCATGGAGCTCATCGTGCAGAAA
GAGGCGCGCAAGTCGGGGCGAAGGAAGACACCGGGGCCGATGGTGCTGAATCGGCTTGGCGAGATTGGCGACATC
CGCAGCGCCATCTCGGCGCTCGAGTTCCTGTGCCTCAAAGGCGACTACGAGGCCGACTGGGGAGCCAAGGTGGCG
TTTACGAAGCAGAAGAAGGGCGTCCGAACAGCCATAGGCCTGACGCAGGGCGAGGCAGAGACTCTCGAGGCCATT
ACGCAGCGCGAGGCCAGTCTCGGCATATTTCACGCCGTTGGCAAAGTCGTGTACAATAAGCGAGACGAGGCGCCT
CCAGCAGACGACAATGTCGAGACGCTGCCGGCCTTTATCGCCGACTTTGCGCGGCCGAACAGATCGCAAGTTCCC
GTCGACAGCCTCATCGACGAGATCGGGACGGACACGCAGACGTTTGTATCGGCCCTGCACGAGAATTACATCCTG
TCTTGCGAAAGCACGGAGCCGATGGACACGTCGACATCGATGGACTACGTCAACGAGTGCATCGAGTACCTCTCC
CTCAGCGACCTGCTCGGACCGTCTCGGGACGTCTTCTTTGGCGGGTTCGGGAGGGATAGCAGCAGCAGTCAGCAA
CTGCGACAAGATGAGATGACGTTTCAGGTGGCCGTTAGAGGCCTGCTGTTCTCGCTGCCGCACCCGGTCAAGCGG
AAACCGACGGGGACGCTCAAGGGCAGTGACGCCTTCAAGATGTTTTACCCGACGAGCATCAAGCTGTGGAAGTCA
AAGGAGGAGATTGAAGGCCTCGTGGACGTGTGGTCATCACGACTACTCAGGGGCGAGGAGCAGCTGGGAAGCAAG
AACTCGACGGACGGCGCCAACGCATTCCGCAAACCGACGACGACATCGTGGACGGATCGGGCGCAACGAGAGGCT
GCGGCGGCGAACAGCGAGGTATCAGAGGCGCGACCGCCCATGTGGCTCGGCAGCACGGCACGACGGGAGATGGTT
CAAGATCGGCTCCCGTACATGGCGCACATGGCACGAGCAAGGAGAAGCGGCACCCGCGATCTGGAGAAGATGGTA
GCTATGCGGGGAACTTGGAAGCCAACAGACGAAGACGGAGACGGAGGCGGAGACCAAGAGCTGGACGGGTCGGCG
GGCGAGGCGTGGGCTACAGACAGGCCATCAGAGGAAGCCAGTCCGCAGAGACGACGTGCTGGGGTGAGGGCGGGA
GAGGTTTCGGGGCTGATGACGCAGAAACTTGTGCTGAGCGACGATGATATTGAGGACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail