Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07199
Gene name
Locationscaffold_09:902362..904311
Strand+
Gene length (bp)1949
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14792 DNA_pol_B_palm DNA polymerase beta palm 6.0E-29 425 559
PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 3.3E-19 375 422
PF14716 HHH_8 Helix-hairpin-helix domain 1.9E-16 291 354
PF14791 DNA_pol_B_thumb DNA polymerase beta thumb 9.5E-12 565 607

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0034061 DNA polymerase activity Yes
GO:1901363 heterocyclic compound binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2148 0.9211 0.1113 0.0115 0.1488 0.1922 0.1336 0.009 0.0695 0.0025

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup485
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5970
Ophiocordyceps australis map64 (Brazil) OphauB2|2294
Ophiocordyceps camponoti-floridani Ophcf2|07199 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2058
Ophiocordyceps camponoti-rufipedis Ophun1|7249
Ophiocordyceps kimflemingae Ophio5|7563
Ophiocordyceps subramaniannii Hirsu2|10849
Ophiocordyceps subramaniannii Hirsu2|6174

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07199
MADAHLESSEKAAFFALWESLGADDEEEMDARERRDRRRRAAFFTDTTEAIEADETVIPDSVRPVTKTKRGDDST
PLPPRRAKSKPSPPTATPGPSGKKRKRGSSPKMKPPEEQIFRDLSFFFVPDNDIAPARRLRITRAREHGARWVRS
AELATHVIVDSDLGFEDKKYRVEGAPVEEEEEEVEEEEVEEEEDKEEKASGPVEMMRGGEEEAVSEDDELARCMS
MMHRYQHLPLDHDDDDDDASREGETSGLGSEVGRDKTTKSGGDRFEDGFLCNQAGEKNAQADGPNGRTIEVLQNM
ADYYERVDDHWRSSGYRKAIGTLRRQTVKVRTADEAVKLPQIGMRIAEKIEEIASTDRLRRLEYAQEEPTDEALQ
LFLHIYGVGSKLARQWVARGYRTLDDVARGARLTASQRVGLEHYHDLRKRIPRREVEAIGEAVRRTAMGIDPGVE
FITGGSYRRGADSSGDVDLIVTKKGTFKAVELLPFLDELVDRLEAEGIVVARLSTPHHGRGNTDTTDTEGGKDVS
GGLSIWHGCCVLPRADPRSPAPTWRRLDMLLVPETQMGGALLYFTGDDLFNRSMRLLARRKGLRLNQRGLFRGGE
LVEGRDEGGSLRFWG*
Coding >Ophcf2|07199
ATGGCCGATGCTCATCTGGAAAGCAGCGAAAAGGCCGCCTTCTTCGCGCTGTGGGAGAGCCTCGGCGCTGACGAT
GAGGAAGAGATGGATGCGCGAGAGCGGCGAGATCGGCGAAGGCGAGCCGCCTTCTTCACGGATACGACCGAAGCC
ATAGAAGCCGATGAGACGGTCATTCCGGACTCGGTGCGGCCGGTGACCAAGACGAAGCGTGGCGATGACTCGACG
CCTCTTCCGCCGCGACGCGCAAAGTCCAAGCCATCACCACCCACCGCGACGCCAGGACCCTCAGGCAAGAAACGA
AAAAGAGGCTCATCGCCAAAGATGAAGCCCCCAGAAGAGCAAATCTTCCGCGACTTATCCTTCTTCTTCGTTCCG
GATAATGACATCGCGCCGGCGCGGAGGCTGCGCATCACGAGGGCGAGGGAGCATGGGGCGCGGTGGGTTAGGAGC
GCTGAGCTGGCGACGCATGTTATCGTCGATTCTGATCTGGGGTTTGAGGACAAGAAGTATCGCGTTGAGGGGGCG
CCGGTTGAGGAGGAGGAGGAGGAGGTTGAGGAGGAGGAGGTTGAGGAGGAGGAGGATAAGGAGGAGAAGGCCAGT
GGACCGGTGGAAATGATGCGCGGAGGAGAAGAAGAAGCAGTCTCGGAGGACGATGAGCTGGCCAGATGCATGTCT
ATGATGCACCGCTATCAACACCTTCCACTCGACCACGATGACGACGACGACGACGCATCACGGGAGGGCGAGACG
TCGGGTCTGGGATCGGAAGTGGGCAGGGATAAGACGACGAAAAGCGGTGGCGATCGATTCGAAGATGGATTTCTC
TGCAACCAGGCCGGCGAGAAGAACGCACAGGCAGACGGTCCCAATGGGCGGACTATCGAAGTTCTGCAGAATATG
GCGGATTACTACGAGCGCGTCGACGACCATTGGCGATCGTCGGGTTATCGCAAGGCCATCGGCACGCTGAGACGT
CAGACGGTCAAGGTGCGGACGGCGGACGAGGCGGTGAAGCTCCCGCAGATCGGAATGCGCATTGCGGAAAAGATT
GAGGAGATTGCATCGACGGATCGGCTACGAAGACTCGAGTATGCGCAGGAGGAGCCGACGGACGAGGCGCTGCAG
CTCTTCCTGCATATCTACGGCGTCGGCAGCAAGCTGGCTCGGCAGTGGGTGGCGCGAGGATACCGGACCCTGGAT
GACGTGGCGAGGGGGGCGCGGCTGACGGCCAGTCAACGGGTTGGGCTGGAGCATTACCACGATCTGAGGAAGAGG
ATTCCGCGGCGGGAGGTTGAGGCTATCGGGGAGGCGGTGAGGCGGACGGCGATGGGTATCGATCCGGGGGTTGAG
TTCATCACGGGCGGGAGTTATCGTCGCGGGGCTGACAGCTCGGGGGATGTGGATTTGATCGTCACCAAGAAGGGG
ACTTTCAAGGCGGTTGAGCTGCTGCCCTTTCTCGATGAGTTGGTGGACCGGCTGGAGGCCGAGGGCATCGTGGTG
GCACGACTATCAACACCGCATCACGGCCGCGGAAACACCGACACCACCGACACCGAAGGCGGGAAAGACGTCAGC
GGCGGCCTCAGCATCTGGCACGGCTGCTGCGTCCTACCCCGAGCAGACCCTCGCAGCCCGGCGCCGACATGGCGC
CGTCTAGATATGCTGCTGGTTCCCGAGACGCAGATGGGGGGCGCGCTGCTGTATTTCACTGGCGACGATCTGTTT
AACCGGAGTATGAGGCTGCTTGCGCGTAGGAAGGGTCTGCGGCTGAACCAGCGGGGGTTGTTTCGCGGGGGGGAG
TTGGTTGAGGGGAGGGATGAGGGGGGATCTTTGAGGTTTTGGGGGTGA
Transcript >Ophcf2|07199
ATGGCCGATGCTCATCTGGAAAGCAGCGAAAAGGCCGCCTTCTTCGCGCTGTGGGAGAGCCTCGGCGCTGACGAT
GAGGAAGAGATGGATGCGCGAGAGCGGCGAGATCGGCGAAGGCGAGCCGCCTTCTTCACGGATACGACCGAAGCC
ATAGAAGCCGATGAGACGGTCATTCCGGACTCGGTGCGGCCGGTGACCAAGACGAAGCGTGGCGATGACTCGACG
CCTCTTCCGCCGCGACGCGCAAAGTCCAAGCCATCACCACCCACCGCGACGCCAGGACCCTCAGGCAAGAAACGA
AAAAGAGGCTCATCGCCAAAGATGAAGCCCCCAGAAGAGCAAATCTTCCGCGACTTATCCTTCTTCTTCGTTCCG
GATAATGACATCGCGCCGGCGCGGAGGCTGCGCATCACGAGGGCGAGGGAGCATGGGGCGCGGTGGGTTAGGAGC
GCTGAGCTGGCGACGCATGTTATCGTCGATTCTGATCTGGGGTTTGAGGACAAGAAGTATCGCGTTGAGGGGGCG
CCGGTTGAGGAGGAGGAGGAGGAGGTTGAGGAGGAGGAGGTTGAGGAGGAGGAGGATAAGGAGGAGAAGGCCAGT
GGACCGGTGGAAATGATGCGCGGAGGAGAAGAAGAAGCAGTCTCGGAGGACGATGAGCTGGCCAGATGCATGTCT
ATGATGCACCGCTATCAACACCTTCCACTCGACCACGATGACGACGACGACGACGCATCACGGGAGGGCGAGACG
TCGGGTCTGGGATCGGAAGTGGGCAGGGATAAGACGACGAAAAGCGGTGGCGATCGATTCGAAGATGGATTTCTC
TGCAACCAGGCCGGCGAGAAGAACGCACAGGCAGACGGTCCCAATGGGCGGACTATCGAAGTTCTGCAGAATATG
GCGGATTACTACGAGCGCGTCGACGACCATTGGCGATCGTCGGGTTATCGCAAGGCCATCGGCACGCTGAGACGT
CAGACGGTCAAGGTGCGGACGGCGGACGAGGCGGTGAAGCTCCCGCAGATCGGAATGCGCATTGCGGAAAAGATT
GAGGAGATTGCATCGACGGATCGGCTACGAAGACTCGAGTATGCGCAGGAGGAGCCGACGGACGAGGCGCTGCAG
CTCTTCCTGCATATCTACGGCGTCGGCAGCAAGCTGGCTCGGCAGTGGGTGGCGCGAGGATACCGGACCCTGGAT
GACGTGGCGAGGGGGGCGCGGCTGACGGCCAGTCAACGGGTTGGGCTGGAGCATTACCACGATCTGAGGAAGAGG
ATTCCGCGGCGGGAGGTTGAGGCTATCGGGGAGGCGGTGAGGCGGACGGCGATGGGTATCGATCCGGGGGTTGAG
TTCATCACGGGCGGGAGTTATCGTCGCGGGGCTGACAGCTCGGGGGATGTGGATTTGATCGTCACCAAGAAGGGG
ACTTTCAAGGCGGTTGAGCTGCTGCCCTTTCTCGATGAGTTGGTGGACCGGCTGGAGGCCGAGGGCATCGTGGTG
GCACGACTATCAACACCGCATCACGGCCGCGGAAACACCGACACCACCGACACCGAAGGCGGGAAAGACGTCAGC
GGCGGCCTCAGCATCTGGCACGGCTGCTGCGTCCTACCCCGAGCAGACCCTCGCAGCCCGGCGCCGACATGGCGC
CGTCTAGATATGCTGCTGGTTCCCGAGACGCAGATGGGGGGCGCGCTGCTGTATTTCACTGGCGACGATCTGTTT
AACCGGAGTATGAGGCTGCTTGCGCGTAGGAAGGGTCTGCGGCTGAACCAGCGGGGGTTGTTTCGCGGGGGGGAG
TTGGTTGAGGGGAGGGATGAGGGGGGATCTTTGAGGTTTTGGGGGTGA
Gene >Ophcf2|07199
ATGGCCGATGCTCATCTGGAAAGCAGCGAAAAGGCCGCCTTCTTCGCGCTGTGGGAGAGCCTCGGCGCTGACGAT
GAGGAAGAGATGGATGCGCGAGAGCGGCGAGATCGGCGAAGGCGAGCCGCCTTCTTCACGGATACGACCGAAGCC
ATAGAAGCCGATGAGACGGTCATTCCGGACTCGGTGCGGCCGGTGACCAAGACGAAGCGTGGCGATGACTCGACG
CCTCTTCCGCCGCGACGCGCAAAGTCCAAGCCATCACCACCCACCGCGACGCCAGGACCCTCAGGCAAGAAACGA
AAAAGAGGCTCATCGCCAAAGATGAAGCCCCCAGAAGAGCAAATCTTCCGCGACTTATCCTTCTTCTTCGTTCCG
GATAATGACATCGCGCCGGCGCGGAGGCTGCGCATCACGAGGGCGAGGGAGCATGGGGCGCGGTGGGTTAGGAGC
GCTGAGCTGGCGACGCATGTTATCGTCGATTCTGATCTGGGGTTTGAGGACGTGAGGAGGGTTTTGGGGGTGGGG
TTGCGGGGGTTAGGGTTGTTAGTGAGCTTTTTTTGGTTGATTGTTTGGTTTTTGGGGCGTTGCTTGATGATGGGC
AGAAGAAGTATCGCGTTGAGGGGGCGCCGGTTGAGGAGGAGGAGGAGGAGGTTGAGGAGGAGGAGGTTGAGGAGG
AGGAGGATAAGGAGGAGAAGGCCAGTGGACCGGTGGAAATGATGCGCGGAGGAGAAGAAGAAGCAGTCTCGGAGG
ACGATGAGCTGGCCAGATGCATGTCTATGATGCACCGCTATCAACACCTTCCACTCGACCACGATGACGACGACG
ACGACGCATCACGGGAGGGCGAGACGTCGGGTCTGGGATCGGAAGTGGGCAGGGATAAGACGACGAAAAGCGGTG
GCGATCGATTCGAAGATGGATTTCTCTGCAACCAGGCCGGCGAGAAGAACGCACAGGCAGACGGTCCCAATGGGC
GGACTATCGAAGTTCTGCAGAATATGGCGGATTACTACGAGCGCGTCGACGACCATTGGCGATCGTCGGGTTATC
GCAAGGCCATCGGCACGCTGAGACGTCAGACGGTCAAGGTGCGGACGGCGGACGAGGCGGTGAAGCTCCCGCAGA
TCGGAATGCGCATTGCGGAAAAGATTGAGGAGATTGCATCGACGGATCGGCTACGAAGACTCGAGTATGCGCAGG
AGGAGCCGACGGACGAGGCGCTGCAGCTCTTCCTGCATATCTACGGCGTCGGCAGCAAGCTGGCTCGGCAGTGGG
TGGCGCGAGGATACCGGACCCTGGATGACGTGGCGAGGGGGGCGCGGCTGACGGCCAGTCAACGGGTTGGGCTGG
AGCATTACCACGATCTGAGGAAGAGGATTCCGCGGCGGGAGGTTGAGGCTATCGGGGAGGCGGTGAGGCGGACGG
CGATGGGTATCGATCCGGGGGTTGAGTTCATCACGGGCGGGAGTTATCGTCGCGGGGCTGACAGCTCGGGGGATG
TGGATTTGATCGTCACCAAGAAGGGGACTTTCAAGGCGGTTGAGCTGCTGCCCTTTCTCGATGAGTTGGTGGACC
GGCTGGAGGCCGAGGGCATCGTGGTGGCACGACTATCAACACCGCATCACGGCCGCGGAAACACCGACACCACCG
ACACCGAAGGCGGGAAAGACGTCAGCGGCGGCCTCAGCATCTGGCACGGCTGCTGCGTCCTACCCCGAGCAGACC
CTCGCAGCCCGGCGCCGACATGGCGCCGTCTAGATATGCTGCTGGTTCCCGAGACGCAGATGGGGGGCGCGCTGC
TGTATTTCACTGGCGACGATCTGTTTAACCGGAGTATGAGGCTGCTTGCGCGTAGGAAGGGTCTGCGGCTGAACC
AGCGGGGGTTGTTTCGCGGGGGGGAGTTGGTTGAGGGGAGGGATGAGGGGGGATCTTTGAGGTTTTGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail