Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07194
Gene name
Locationscaffold_09:882966..887563
Strand+
Gene length (bp)4597
Transcript length (bp)4527
Coding sequence length (bp)4527
Protein length (aa) 1509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 4.4E-139 60 507
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 4.1E-150 742 1195
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 2.5E-45 517 678
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 3.5E-41 1198 1363

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 1378 1400 22
2 1429 1451 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07194
MRLRGSAPWRILLASLFWTTLVIAKDAPDLTVNKFNHPPLSLHYFEDSDVVVFHDVEERNVYRSKDAGVSWSRVD
AVPEGKSVALVMHASDPKSAFVLTASGSHYKTDNRGDGWREFKTKSMPSKFQPEILIFHADDPNRIIFNGMDCEG
IFCDEQALYTTDGFKSVKLLRSFTVGCWWARSSKAFTTGDAELDKSRVLCVVKDPFSFFRQDQRLLVSDSYFAVA
GNTIQEFEPNVDGNKGASGVMNYAAVNKFVLVATASARSDEMALFVTGDTIKWHRAMFPTDGSHDHSHRIHQEAY
TVLEGTNYSIQIDVMTSRPSNPMGVLFTSNSNGTMFTENIAFTNRNIKGHVDFEKISGIQGIFLVNVVDNGDEVS
KKSANKNVVTKITFDDGRTFHKIKVGDETLHLHSVTELDNVGRVFSSPAPGLVMGNGNVGKSLTKLSEANLHVSD
DAGLTWRKALDGPHKFEFGDSGSVLVAIKDSVKEDVKDFSYSLDHGQNWKSVSLPNDLSIKPGLLTTTQDSTSLK
FLLMGRSKKTYHLVAINFEGLHERTCGEDDMEDWHARVDKDGKPTCVMGHKQTYRRRKKSADCFVKNEFKDPVPK
SEDCECADVDFECDYNFQRDADDKSKCKKVGPVPVPEGECKGKAGGTFKGSSGWRLIPGNTCKRTSGPQKDDKVD
RDCSDSVTAPTPPASDKVTSKQFVFDSKLKDFEKMYLERSDASSSTDETIIVRPAEYEGSGRMKVENRLWISHDH
GKEWERILKGEEVEGVYPHQYFKDVVFFTTTGDKILYTVDRGQSFHPIKAPTKPSSGEVNLSFHPDKKDWLIWLG
EKCEKVGDKKSCHNEASLSTDRGDNWRTIERYVERCEFTGNSAYNFRETKQIVCLVRKGEKKDGPMSLVSSNDFF
FEDKTTLEHEAINFATMSEFIVLAAKDEKTKDMLALASLDGKHFDKAHYPHNFRKGHQNQYTLLDSSTHAINLFV
RTEGGADRQYGSVIKSNSNGTSYVLSATDVNCNQETYVDFEKVAGLEGVVLINVVTNTDKKERKKVLQTKISHND
GSEWGYLAPPAKDADGKAYQCSSSKGDGSCALHLHHFTERDDRRRTFAADTAVGLLFGIGNVGSSLGDVKDADTF
LSTDGGMTWTCVKKGEWTWQYGDQGSIMVLVQRATRANPVKTKTVSYSLDEGRTWADHQFSDSEVTVLDITTLKS
GTSRNFLVWCKSKDKAFSVNLDFSGLAGKACKFDKDAPSDSDYYLWSPKHPLQDDDCLFGHVARYLRKKTDRKCY
NDQSLQRLFDHKNCACSRRDYECAYNYELDQHGQCALVAGLKPLSGDEWCAKHPNETSWFEPTGYRKVPLSTCQG
GNELDKTSTEHACAGHEKEFEKKHRTSGAAIFLAVTIPFALAGAIGWYVYRNWDGKLGQIRLGEQTSTFDSDRLW
IKYPVIAVSAVAALATALPLILAGLWRSATGTYGRVRGDGRDAWFSPGTRTFTTRDSFARGRGDYAMVDDEGELL
GQDSDEDV*
Coding >Ophcf2|07194
ATGAGGCTCCGAGGCTCGGCGCCGTGGCGCATCCTGCTCGCGTCCCTCTTCTGGACGACGCTGGTCATCGCCAAG
GATGCGCCCGACTTGACCGTCAACAAGTTCAACCATCCGCCGCTTTCCCTCCACTACTTCGAGGATAGCGATGTC
GTCGTCTTCCACGATGTCGAGGAGCGCAACGTCTACCGCTCCAAAGACGCCGGAGTCAGCTGGTCCCGAGTCGAC
GCCGTCCCCGAGGGCAAGTCGGTGGCCCTCGTCATGCACGCCTCCGATCCCAAGTCGGCCTTTGTCCTGACGGCC
AGCGGATCGCACTACAAGACGGACAATCGCGGTGACGGCTGGAGAGAGTTCAAGACAAAGTCAATGCCCAGCAAG
TTTCAGCCCGAGATCCTCATCTTTCACGCCGACGACCCCAATCGCATCATCTTCAACGGCATGGACTGCGAGGGC
ATATTTTGCGACGAGCAGGCCCTCTATACAACCGACGGCTTCAAGTCTGTCAAGCTTCTGCGCTCCTTTACCGTG
GGATGCTGGTGGGCGAGGTCCTCCAAGGCCTTTACCACGGGCGATGCCGAACTCGACAAATCGCGCGTCCTCTGT
GTCGTCAAGGACCCATTCTCCTTCTTCCGACAGGATCAGCGCCTGCTCGTCTCCGACTCGTACTTTGCCGTCGCC
GGCAACACCATTCAAGAGTTCGAGCCCAACGTCGACGGGAACAAGGGCGCCTCGGGCGTCATGAACTACGCCGCC
GTCAACAAGTTCGTCCTCGTCGCCACCGCTTCGGCTCGCAGCGATGAAATGGCCCTTTTCGTCACCGGTGATACC
ATCAAGTGGCATCGCGCCATGTTCCCAACTGACGGGAGTCACGACCATTCCCACCGCATCCACCAGGAAGCTTAC
ACCGTTCTCGAGGGCACCAATTACAGCATCCAGATCGATGTCATGACATCCCGGCCCTCAAACCCGATGGGGGTC
CTCTTCACCAGCAACTCCAATGGTACCATGTTTACAGAGAACATCGCCTTTACCAACCGCAACATCAAGGGCCAC
GTCGACTTCGAAAAGATCTCGGGCATACAGGGCATCTTCCTCGTCAACGTCGTCGACAACGGCGACGAGGTCAGC
AAGAAGAGCGCGAACAAGAATGTGGTGACCAAAATCACATTTGACGACGGCAGGACCTTTCACAAGATCAAGGTC
GGCGACGAGACGCTTCACCTCCACTCCGTCACCGAGCTCGACAACGTCGGTCGCGTATTCTCCAGCCCGGCGCCG
GGGCTCGTCATGGGCAACGGAAACGTCGGCAAGTCCCTGACGAAGCTCAGCGAAGCCAACCTGCACGTCTCAGAC
GACGCCGGCCTGACATGGCGCAAGGCCCTCGACGGCCCTCACAAGTTCGAATTCGGCGACTCGGGTTCCGTGCTC
GTCGCCATCAAGGACTCGGTCAAAGAGGACGTCAAGGACTTCTCCTACTCCCTCGACCACGGCCAGAACTGGAAG
AGCGTCTCCCTGCCCAACGACCTCAGCATCAAGCCCGGACTTTTGACTACGACGCAAGACTCGACCAGCCTCAAG
TTCCTGCTCATGGGCCGCAGCAAGAAGACGTATCACTTGGTCGCGATAAACTTTGAAGGATTACACGAGCGGACC
TGCGGTGAGGACGACATGGAGGACTGGCACGCCCGTGTGGACAAGGATGGGAAGCCGACGTGCGTCATGGGTCAC
AAGCAGACGTATCGCCGTCGCAAGAAGTCGGCCGACTGCTTCGTCAAGAACGAGTTCAAAGACCCCGTTCCCAAG
TCGGAGGACTGCGAATGCGCCGACGTCGACTTCGAGTGCGACTACAACTTCCAGAGGGATGCCGACGACAAGAGC
AAATGCAAAAAGGTCGGGCCCGTCCCAGTACCGGAAGGCGAGTGCAAGGGCAAGGCCGGGGGCACCTTCAAGGGG
TCCAGCGGCTGGAGGCTCATCCCCGGCAACACGTGCAAGAGGACGAGCGGGCCGCAAAAGGACGACAAGGTCGAC
AGGGACTGCTCCGACAGCGTGACGGCCCCGACGCCTCCGGCCAGCGACAAGGTGACGAGTAAGCAGTTCGTCTTC
GACTCCAAGCTCAAGGACTTCGAAAAGATGTACCTCGAGAGGAGCGACGCGAGCTCGTCGACGGACGAGACCATC
ATCGTCCGGCCGGCCGAGTACGAGGGCAGCGGACGGATGAAGGTGGAAAACCGGCTATGGATCTCGCACGACCAC
GGCAAAGAGTGGGAGCGCATCCTCAAGGGCGAGGAAGTCGAGGGCGTCTATCCTCATCAGTACTTCAAGGACGTC
GTCTTCTTCACCACGACGGGCGACAAGATTCTGTACACGGTCGACCGCGGCCAGTCCTTCCACCCCATCAAGGCG
CCCACGAAGCCGTCGTCTGGCGAAGTCAACCTCAGCTTCCACCCGGACAAGAAGGACTGGCTGATATGGCTGGGC
GAGAAGTGCGAAAAGGTGGGAGACAAGAAGTCGTGTCACAACGAGGCGTCGCTGTCGACGGACCGCGGAGACAAC
TGGCGGACCATCGAGCGCTACGTCGAGCGGTGCGAGTTTACGGGCAACTCGGCCTACAACTTCCGCGAGACGAAG
CAGATTGTCTGTCTCGTCAGGAAGGGGGAGAAGAAGGACGGTCCCATGTCGCTGGTTTCGAGCAACGACTTCTTC
TTCGAGGACAAGACGACGCTCGAACACGAAGCAATCAACTTTGCCACGATGAGCGAGTTCATCGTCTTGGCCGCC
AAGGACGAAAAGACCAAGGACATGTTGGCGCTCGCCAGTCTCGACGGCAAGCATTTCGACAAGGCGCACTACCCT
CACAACTTCCGCAAGGGACACCAGAACCAGTACACGCTGCTCGACAGCTCGACGCACGCCATCAACCTGTTTGTG
AGGACCGAGGGAGGGGCGGATCGGCAGTACGGGTCCGTCATCAAGAGCAACTCCAACGGCACGAGCTACGTGTTG
AGCGCGACCGACGTCAACTGCAATCAGGAGACGTACGTCGACTTTGAAAAAGTGGCGGGCCTCGAGGGCGTCGTC
TTGATCAACGTGGTGACCAACACGGACAAGAAGGAGAGGAAAAAGGTGCTGCAGACCAAGATCTCGCACAACGAC
GGCTCGGAATGGGGATACCTGGCGCCGCCGGCCAAAGACGCCGACGGTAAGGCGTATCAGTGCAGCAGCTCCAAG
GGCGATGGCTCGTGCGCCCTCCACCTGCATCACTTCACCGAGCGGGACGATCGGAGACGGACCTTTGCGGCCGAC
ACTGCAGTCGGTCTCCTGTTCGGCATCGGGAACGTCGGCTCCAGCCTGGGCGACGTCAAGGATGCCGATACCTTT
CTGTCGACGGACGGCGGTATGACGTGGACCTGTGTCAAGAAGGGCGAATGGACGTGGCAGTACGGCGATCAGGGG
TCCATCATGGTTCTGGTCCAGCGGGCGACTCGGGCCAACCCGGTCAAGACGAAGACGGTGTCTTACTCGCTCGAC
GAGGGCAGGACCTGGGCCGATCACCAGTTCTCCGACAGTGAAGTGACGGTGCTCGACATCACGACGCTCAAGTCG
GGCACGTCTCGCAACTTTCTCGTCTGGTGCAAGTCCAAGGACAAGGCCTTTTCCGTCAACCTCGACTTTAGCGGC
CTGGCCGGCAAGGCCTGCAAGTTCGACAAGGACGCCCCTTCGGACTCGGACTATTATCTCTGGTCGCCCAAGCAC
CCGCTGCAAGACGACGACTGTCTGTTCGGTCATGTGGCCCGTTATCTGCGCAAGAAGACGGACCGCAAGTGCTAC
AACGACCAGAGCCTGCAGCGGCTGTTTGACCACAAGAACTGCGCGTGCAGCCGGCGAGACTATGAATGCGCGTAC
AACTACGAGCTCGATCAGCACGGCCAGTGTGCCCTGGTAGCCGGTCTCAAGCCCCTATCAGGCGACGAGTGGTGC
GCCAAGCACCCCAACGAAACATCGTGGTTCGAGCCGACCGGATACCGCAAAGTGCCACTATCGACCTGTCAGGGA
GGCAACGAGCTCGACAAGACGTCAACGGAACACGCATGCGCAGGCCACGAGAAGGAATTCGAGAAGAAGCACCGC
ACGTCCGGAGCCGCCATCTTCCTAGCCGTCACCATACCCTTCGCACTAGCCGGCGCAATCGGCTGGTACGTCTAC
CGCAACTGGGACGGGAAACTCGGCCAGATCCGTCTCGGCGAGCAGACCTCCACCTTTGACAGCGACAGGCTATGG
ATCAAGTACCCCGTCATCGCCGTCTCCGCCGTCGCGGCCCTGGCGACGGCCCTTCCGCTCATCCTCGCCGGCCTC
TGGCGCTCCGCTACCGGCACGTACGGTCGCGTCAGGGGTGACGGTCGAGATGCCTGGTTCTCGCCCGGAACGAGG
ACTTTTACCACGAGGGATAGCTTCGCGCGCGGAAGGGGGGATTACGCCATGGTTGATGATGAGGGCGAGCTGTTG
GGTCAAGACAGTGATGAGGACGTCTGA
Transcript >Ophcf2|07194
ATGAGGCTCCGAGGCTCGGCGCCGTGGCGCATCCTGCTCGCGTCCCTCTTCTGGACGACGCTGGTCATCGCCAAG
GATGCGCCCGACTTGACCGTCAACAAGTTCAACCATCCGCCGCTTTCCCTCCACTACTTCGAGGATAGCGATGTC
GTCGTCTTCCACGATGTCGAGGAGCGCAACGTCTACCGCTCCAAAGACGCCGGAGTCAGCTGGTCCCGAGTCGAC
GCCGTCCCCGAGGGCAAGTCGGTGGCCCTCGTCATGCACGCCTCCGATCCCAAGTCGGCCTTTGTCCTGACGGCC
AGCGGATCGCACTACAAGACGGACAATCGCGGTGACGGCTGGAGAGAGTTCAAGACAAAGTCAATGCCCAGCAAG
TTTCAGCCCGAGATCCTCATCTTTCACGCCGACGACCCCAATCGCATCATCTTCAACGGCATGGACTGCGAGGGC
ATATTTTGCGACGAGCAGGCCCTCTATACAACCGACGGCTTCAAGTCTGTCAAGCTTCTGCGCTCCTTTACCGTG
GGATGCTGGTGGGCGAGGTCCTCCAAGGCCTTTACCACGGGCGATGCCGAACTCGACAAATCGCGCGTCCTCTGT
GTCGTCAAGGACCCATTCTCCTTCTTCCGACAGGATCAGCGCCTGCTCGTCTCCGACTCGTACTTTGCCGTCGCC
GGCAACACCATTCAAGAGTTCGAGCCCAACGTCGACGGGAACAAGGGCGCCTCGGGCGTCATGAACTACGCCGCC
GTCAACAAGTTCGTCCTCGTCGCCACCGCTTCGGCTCGCAGCGATGAAATGGCCCTTTTCGTCACCGGTGATACC
ATCAAGTGGCATCGCGCCATGTTCCCAACTGACGGGAGTCACGACCATTCCCACCGCATCCACCAGGAAGCTTAC
ACCGTTCTCGAGGGCACCAATTACAGCATCCAGATCGATGTCATGACATCCCGGCCCTCAAACCCGATGGGGGTC
CTCTTCACCAGCAACTCCAATGGTACCATGTTTACAGAGAACATCGCCTTTACCAACCGCAACATCAAGGGCCAC
GTCGACTTCGAAAAGATCTCGGGCATACAGGGCATCTTCCTCGTCAACGTCGTCGACAACGGCGACGAGGTCAGC
AAGAAGAGCGCGAACAAGAATGTGGTGACCAAAATCACATTTGACGACGGCAGGACCTTTCACAAGATCAAGGTC
GGCGACGAGACGCTTCACCTCCACTCCGTCACCGAGCTCGACAACGTCGGTCGCGTATTCTCCAGCCCGGCGCCG
GGGCTCGTCATGGGCAACGGAAACGTCGGCAAGTCCCTGACGAAGCTCAGCGAAGCCAACCTGCACGTCTCAGAC
GACGCCGGCCTGACATGGCGCAAGGCCCTCGACGGCCCTCACAAGTTCGAATTCGGCGACTCGGGTTCCGTGCTC
GTCGCCATCAAGGACTCGGTCAAAGAGGACGTCAAGGACTTCTCCTACTCCCTCGACCACGGCCAGAACTGGAAG
AGCGTCTCCCTGCCCAACGACCTCAGCATCAAGCCCGGACTTTTGACTACGACGCAAGACTCGACCAGCCTCAAG
TTCCTGCTCATGGGCCGCAGCAAGAAGACGTATCACTTGGTCGCGATAAACTTTGAAGGATTACACGAGCGGACC
TGCGGTGAGGACGACATGGAGGACTGGCACGCCCGTGTGGACAAGGATGGGAAGCCGACGTGCGTCATGGGTCAC
AAGCAGACGTATCGCCGTCGCAAGAAGTCGGCCGACTGCTTCGTCAAGAACGAGTTCAAAGACCCCGTTCCCAAG
TCGGAGGACTGCGAATGCGCCGACGTCGACTTCGAGTGCGACTACAACTTCCAGAGGGATGCCGACGACAAGAGC
AAATGCAAAAAGGTCGGGCCCGTCCCAGTACCGGAAGGCGAGTGCAAGGGCAAGGCCGGGGGCACCTTCAAGGGG
TCCAGCGGCTGGAGGCTCATCCCCGGCAACACGTGCAAGAGGACGAGCGGGCCGCAAAAGGACGACAAGGTCGAC
AGGGACTGCTCCGACAGCGTGACGGCCCCGACGCCTCCGGCCAGCGACAAGGTGACGAGTAAGCAGTTCGTCTTC
GACTCCAAGCTCAAGGACTTCGAAAAGATGTACCTCGAGAGGAGCGACGCGAGCTCGTCGACGGACGAGACCATC
ATCGTCCGGCCGGCCGAGTACGAGGGCAGCGGACGGATGAAGGTGGAAAACCGGCTATGGATCTCGCACGACCAC
GGCAAAGAGTGGGAGCGCATCCTCAAGGGCGAGGAAGTCGAGGGCGTCTATCCTCATCAGTACTTCAAGGACGTC
GTCTTCTTCACCACGACGGGCGACAAGATTCTGTACACGGTCGACCGCGGCCAGTCCTTCCACCCCATCAAGGCG
CCCACGAAGCCGTCGTCTGGCGAAGTCAACCTCAGCTTCCACCCGGACAAGAAGGACTGGCTGATATGGCTGGGC
GAGAAGTGCGAAAAGGTGGGAGACAAGAAGTCGTGTCACAACGAGGCGTCGCTGTCGACGGACCGCGGAGACAAC
TGGCGGACCATCGAGCGCTACGTCGAGCGGTGCGAGTTTACGGGCAACTCGGCCTACAACTTCCGCGAGACGAAG
CAGATTGTCTGTCTCGTCAGGAAGGGGGAGAAGAAGGACGGTCCCATGTCGCTGGTTTCGAGCAACGACTTCTTC
TTCGAGGACAAGACGACGCTCGAACACGAAGCAATCAACTTTGCCACGATGAGCGAGTTCATCGTCTTGGCCGCC
AAGGACGAAAAGACCAAGGACATGTTGGCGCTCGCCAGTCTCGACGGCAAGCATTTCGACAAGGCGCACTACCCT
CACAACTTCCGCAAGGGACACCAGAACCAGTACACGCTGCTCGACAGCTCGACGCACGCCATCAACCTGTTTGTG
AGGACCGAGGGAGGGGCGGATCGGCAGTACGGGTCCGTCATCAAGAGCAACTCCAACGGCACGAGCTACGTGTTG
AGCGCGACCGACGTCAACTGCAATCAGGAGACGTACGTCGACTTTGAAAAAGTGGCGGGCCTCGAGGGCGTCGTC
TTGATCAACGTGGTGACCAACACGGACAAGAAGGAGAGGAAAAAGGTGCTGCAGACCAAGATCTCGCACAACGAC
GGCTCGGAATGGGGATACCTGGCGCCGCCGGCCAAAGACGCCGACGGTAAGGCGTATCAGTGCAGCAGCTCCAAG
GGCGATGGCTCGTGCGCCCTCCACCTGCATCACTTCACCGAGCGGGACGATCGGAGACGGACCTTTGCGGCCGAC
ACTGCAGTCGGTCTCCTGTTCGGCATCGGGAACGTCGGCTCCAGCCTGGGCGACGTCAAGGATGCCGATACCTTT
CTGTCGACGGACGGCGGTATGACGTGGACCTGTGTCAAGAAGGGCGAATGGACGTGGCAGTACGGCGATCAGGGG
TCCATCATGGTTCTGGTCCAGCGGGCGACTCGGGCCAACCCGGTCAAGACGAAGACGGTGTCTTACTCGCTCGAC
GAGGGCAGGACCTGGGCCGATCACCAGTTCTCCGACAGTGAAGTGACGGTGCTCGACATCACGACGCTCAAGTCG
GGCACGTCTCGCAACTTTCTCGTCTGGTGCAAGTCCAAGGACAAGGCCTTTTCCGTCAACCTCGACTTTAGCGGC
CTGGCCGGCAAGGCCTGCAAGTTCGACAAGGACGCCCCTTCGGACTCGGACTATTATCTCTGGTCGCCCAAGCAC
CCGCTGCAAGACGACGACTGTCTGTTCGGTCATGTGGCCCGTTATCTGCGCAAGAAGACGGACCGCAAGTGCTAC
AACGACCAGAGCCTGCAGCGGCTGTTTGACCACAAGAACTGCGCGTGCAGCCGGCGAGACTATGAATGCGCGTAC
AACTACGAGCTCGATCAGCACGGCCAGTGTGCCCTGGTAGCCGGTCTCAAGCCCCTATCAGGCGACGAGTGGTGC
GCCAAGCACCCCAACGAAACATCGTGGTTCGAGCCGACCGGATACCGCAAAGTGCCACTATCGACCTGTCAGGGA
GGCAACGAGCTCGACAAGACGTCAACGGAACACGCATGCGCAGGCCACGAGAAGGAATTCGAGAAGAAGCACCGC
ACGTCCGGAGCCGCCATCTTCCTAGCCGTCACCATACCCTTCGCACTAGCCGGCGCAATCGGCTGGTACGTCTAC
CGCAACTGGGACGGGAAACTCGGCCAGATCCGTCTCGGCGAGCAGACCTCCACCTTTGACAGCGACAGGCTATGG
ATCAAGTACCCCGTCATCGCCGTCTCCGCCGTCGCGGCCCTGGCGACGGCCCTTCCGCTCATCCTCGCCGGCCTC
TGGCGCTCCGCTACCGGCACGTACGGTCGCGTCAGGGGTGACGGTCGAGATGCCTGGTTCTCGCCCGGAACGAGG
ACTTTTACCACGAGGGATAGCTTCGCGCGCGGAAGGGGGGATTACGCCATGGTTGATGATGAGGGCGAGCTGTTG
GGTCAAGACAGTGATGAGGACGTCTGA
Gene >Ophcf2|07194
ATGAGGCTCCGAGGCTCGGCGCCGTGGCGCATCCTGCTCGCGTCCCTCTTCTGGACGACGCTGGTCATCGCCAAG
GATGCGCCCGACTTGACCGTCAACAAGTTCAACCATCCGCCGCTTTCCCTCCACTACTTCGAGGATAGCGATGTC
GTCGTCTTCCACGATGTCGAGGAGCGCAACGTCTACCGCTCCAAAGACGCCGGAGTCAGCTGGTCCCGAGTCGAC
GCCGTCCCCGAGGGCAAGTCGGTGGCCCTCGTCATGCACGCCTCCGATCCCAAGTCGGCCTTTGTCCTGACGGCC
AGCGGATCGCACTACAAGACGGACAATCGCGGTGACGGCTGGAGAGAGTTCAAGACAAAGTCAATGCCCAGCAAG
TTTCAGCCCGAGATCCTCATCTTTCACGCCGACGACCCCAATCGCATCATCTTCAACGGCATGGACTGCGAGGGC
ATATTTTGCGACGAGCAGGCCCTCTATACAACCGACGGCTTCAAGTCTGTCAAGCTTCTGCGCTCCTTTACCGTG
GGATGCTGGTGGGCGAGGTCCTCCAAGGCCTTTACCACGGGCGATGCCGAACTCGACAAATCGCGCGTCCTCTGT
GTCGTCAAGGACCCATTCTCCTTCTTCCGACAGGATCAGCGCCTGCTCGTCTCCGACTCGTACTTTGCCGTCGCC
GGCAACACCATTCAAGAGTTCGAGCCCAACGTCGACGGGAACAAGGGCGCCTCGGGCGTCATGAACTACGCCGCC
GTCAACAAGTTCGTCCTCGTCGCCACCGCTTCGGCTCGCAGCGATGAAATGGCCCTTTTCGTCACCGGTGATACC
ATCAAGTGGCATCGCGCCATGTTCCCAACTGACGGGAGTCACGACCATTCCCACCGCATCCACCAGGAAGCTTAC
ACCGTTCTCGAGGGCACCAATTACAGCATCCAGATCGATGTCATGACATCCCGGCCCTCAAACCCGATGGGGGTC
CTCTTCACCAGCAACTCCAATGGTACCATGTTTACAGAGAACATCGCCTTTACCAACCGCAACATCAAGGGCCAC
GTCGACTTCGAAAAGATCTCGGGCATACAGGGCATCTTCCTCGTCAACGTCGTCGACAACGGCGACGAGGTCAGC
AAGAAGAGCGCGAACAAGAATGTGGTGACCAAAATCACATTTGACGACGGCAGGACCTTTCACAAGATCAAGGTC
GGCGACGAGACGCTTCACCTCCACTCCGTCACCGAGCTCGACAACGTCGGTCGCGTATTCTCCAGCCCGGCGCCG
GGGCTCGTCATGGGCAACGGAAACGTCGGCAAGTCCCTGACGAAGCTCAGCGAAGCCAACCTGCACGTCTCAGAC
GACGCCGGCCTGACATGGCGCAAGGCCCTCGACGGCCCTCACAAGTTCGAATTCGGCGACTCGGGTTCCGTGCTC
GTCGCCATCAAGGACTCGGTCAAAGAGGACGTCAAGGACTTCTCCTACTCCCTCGACCACGGCCAGAACTGGAAG
AGCGTCTCCCTGCCCAACGACCTCAGCATCAAGCCCGGACTTTTGACTACGACGCAAGACTCGACCAGCCTCAAG
TTCCTGCTCATGGGCCGCAGCAAGAAGACGTATCACTTGGTCGCGATAAACTTTGAAGGATTACACGAGCGGACC
TGCGGTGAGGACGACATGGAGGACTGGCACGCCCGTGTGGACAAGGATGGGAAGCCGACGTGCGTCATGGGTCAC
AAGCAGACGTATCGCCGTCGCAAGAAGTCGGCCGACTGCTTCGTCAAGAACGAGTTCAAAGACCCCGTTCCCAAG
TCGGAGGACTGCGAATGCGCCGACGTCGACTTCGAGTGCGACTACAACTTCCAGAGGGATGCCGACGACAAGAGC
AAATGCAAAAAGGTCGGGCCCGTCCCAGTACCGGAAGGCGAGTGCAAGGGCAAGGCCGGGGGCACCTTCAAGGGG
TCCAGCGGCTGGAGGCTCATCCCCGGCAACACGTGCAAGAGGACGAGCGGGCCGCAAAAGGACGACAAGGTCGAC
AGGGACTGCTCCGACAGCGTGACGGCCCCGACGCCTCCGGCCAGCGACAAGGTGACGAGTAAGCAGTTCGTCTTC
GACTCCAAGCTCAAGGACTTCGAAAAGATGTACCTCGAGAGGAGCGACGCGAGCTCGTCGACGGACGAGACCATC
ATCGTCCGGCCGGCCGAGTACGAGGGCAGCGGACGGATGAAGGTGGAAAACCGGCTATGGATCTCGCACGACCAC
GGCAAAGAGTGGGAGCGCATCCTCAAGGGCGAGGAAGTCGAGGGCGTCTATCCTCATCAGTACTTCAAGGACGTC
GTCTTCTTCACCACGACGGGCGACAAGATTCTGTACACGGTCGACCGCGGCCAGTCCTTCCACCCCATCAAGGCG
CCCACGAAGCCGTCGTCTGGCGAAGTCAACCTCAGCTTCCACCCGGACAAGAAGGACTGGCTGATATGGCTGGGC
GAGAAGTGCGAAAAGGTGGGAGACAAGAAGTCGTGTCACAACGAGGCGTCGCTGTCGACGGACCGCGGAGACAAC
TGGCGGACCATCGAGCGCTACGTCGAGCGGTGCGAGTTTACGGGCAACTCGGCCTACAACTTCCGCGAGACGAAG
CAGATTGTCTGTCTCGTCAGGAAGGGGGAGAAGAAGGACGGTCCCATGTCGCTGGTTTCGAGCAACGACTTCTTC
TTCGAGGACAAGACGACGCTCGAACACGAAGCAATCAACTTTGCCACGATGAGCGAGTTCATCGTCTTGGCCGCC
AAGGACGAAAAGACCAAGGACATGTTGGCGCTCGCCAGTCTCGACGGCAAGCATTTCGACAAGGCGCACTACCCT
CACAACTTCCGCAAGGGACACCAGAACCAGTACACGCTGCTCGACAGCTCGACGCACGCCATCAACCTGTTTGTG
AGGACCGAGGGAGGGGCGGATCGGCAGTACGGGTCCGTCATCAAGAGCAACTCCAACGGCACGAGCTACGTGTTG
AGCGCGACCGACGTCAACTGCAATCAGGAGACGTACGTCGACTTTGAAAAAGTGGCGGGCCTCGAGGGCGTCGTC
TTGATCAACGTGGTGACCAACACGGACAAGAAGGAGAGGAAAAAGGTGCTGCAGACCAAGATCTCGCACAACGAC
GGCTCGGAATGGGGATACCTGGCGCCGCCGGCCAAAGACGCCGACGGTAAGGCGTATCAGTGCAGCAGCTCCAAG
GGCGATGGCTCGTGCGCCCTCCACCTGCATCACTTCACCGAGCGGGACGATCGGAGACGGACCTTTGCGGCCGAC
ACTGCAGTCGGTCTCCTGTTCGGCATCGGGAACGTCGGCTCCAGCCTGGGCGACGTCAAGGATGCCGATACCTTT
CTGTCGACGGACGGCGGTATGACGTGGACCTGTGTCAAGAAGGGCGAATGGACGTGGCAGTACGGCGATCAGGGG
TCCATCATGGTTCTGGTCCAGCGGGCGACTCGGGCCAACCCGGTCAAGACGAAGACGGTGTCTTACTCGCTCGAC
GAGGGCAGGACCTGGGCCGATCACCAGTTCTCCGACAGTGAAGTGACGGTGCTCGACATCACGACGCTCAAGTCG
GGCACGTCTCGCAACTTTCTCGTCTGGTGCAAGTCCAAGGACAAGGCCTTTTCCGTCAACCTCGACTTTAGCGGC
CTGGCCGGCAAGGCCTGCAAGTTCGACAAGGACGCCCCTTCGGACTCGGACTATTATCTCTGGTCGCCCAAGCAC
CCGCTGCAAGACGACGACTGTCTGTTCGGTCATGTGGCCCGTTATCTGCGCAAGAAGACGGACCGCAAGTGCTAC
AACGACCAGAGCCTGCAGCGGCTGTTTGACCACAAGAACTGCGCGTGCAGCCGGCGAGACTATGAATGGTGAGTT
TCCCCCCTTTTGGGTTGCGTCTCTTGTCTGTACTCTTGGGAGAGACTGAGACGAAACGCACAGCGCGTACAACTA
CGAGCTCGATCAGCACGGCCAGTGTGCCCTGGTAGCCGGTCTCAAGCCCCTATCAGGCGACGAGTGGTGCGCCAA
GCACCCCAACGAAACATCGTGGTTCGAGCCGACCGGATACCGCAAAGTGCCACTATCGACCTGTCAGGGAGGCAA
CGAGCTCGACAAGACGTCAACGGAACACGCATGCGCAGGCCACGAGAAGGAATTCGAGAAGAAGCACCGCACGTC
CGGAGCCGCCATCTTCCTAGCCGTCACCATACCCTTCGCACTAGCCGGCGCAATCGGCTGGTACGTCTACCGCAA
CTGGGACGGGAAACTCGGCCAGATCCGTCTCGGCGAGCAGACCTCCACCTTTGACAGCGACAGGCTATGGATCAA
GTACCCCGTCATCGCCGTCTCCGCCGTCGCGGCCCTGGCGACGGCCCTTCCGCTCATCCTCGCCGGCCTCTGGCG
CTCCGCTACCGGCACGTACGGTCGCGTCAGGGGTGACGGTCGAGATGCCTGGTTCTCGCCCGGAACGAGGACTTT
TACCACGAGGGATAGCTTCGCGCGCGGAAGGGGGGATTACGCCATGGTTGATGATGAGGGCGAGCTGTTGGGTCA
AGACAGTGATGAGGACGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail