Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07188
Gene name
Locationscaffold_09:869287..869861
Strand+
Gene length (bp)574
Transcript length (bp)381
Coding sequence length (bp)381
Protein length (aa) 127

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 7.2E-40 11 125

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7184 0.3913 0.2182 0.2566 0.57 0.1498 0.1323 0.0842 0.1556 0.0116

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup959
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1690
Ophiocordyceps australis map64 (Brazil) OphauB2|2281
Ophiocordyceps camponoti-floridani Ophcf2|07188 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2343
Ophiocordyceps kimflemingae Ophio5|556
Ophiocordyceps subramaniannii Hirsu2|7258

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07188
MADQQQVVFTANAPTPLGPYSQAIKTPTAIYCSGQIPLTSDGVMIEGSIAEKTTQCCKNLEAVLTEAGSSLRKIV
KLNVFLSDMAHFAEMNSTYERFFPHKPARSCVAVKTLPRNVDVEIEAIALP*
Coding >Ophcf2|07188
ATGGCGGACCAGCAGCAAGTCGTCTTCACTGCCAACGCCCCCACGCCTCTCGGCCCTTACTCTCAAGCCATCAAG
ACCCCCACGGCCATCTACTGCTCGGGCCAGATTCCCTTGACCTCCGATGGCGTAATGATCGAGGGCTCCATCGCC
GAAAAGACGACGCAGTGCTGCAAGAACCTTGAGGCCGTCCTGACCGAGGCCGGGTCTTCCCTCCGCAAGATCGTC
AAGTTAAACGTCTTTCTGTCCGACATGGCTCATTTCGCCGAGATGAATTCCACGTATGAAAGGTTCTTCCCTCAC
AAGCCCGCCCGCAGCTGCGTGGCCGTCAAGACGCTTCCCAGGAACGTCGACGTCGAGATCGAAGCCATTGCCCTG
CCCTAG
Transcript >Ophcf2|07188
ATGGCGGACCAGCAGCAAGTCGTCTTCACTGCCAACGCCCCCACGCCTCTCGGCCCTTACTCTCAAGCCATCAAG
ACCCCCACGGCCATCTACTGCTCGGGCCAGATTCCCTTGACCTCCGATGGCGTAATGATCGAGGGCTCCATCGCC
GAAAAGACGACGCAGTGCTGCAAGAACCTTGAGGCCGTCCTGACCGAGGCCGGGTCTTCCCTCCGCAAGATCGTC
AAGTTAAACGTCTTTCTGTCCGACATGGCTCATTTCGCCGAGATGAATTCCACGTATGAAAGGTTCTTCCCTCAC
AAGCCCGCCCGCAGCTGCGTGGCCGTCAAGACGCTTCCCAGGAACGTCGACGTCGAGATCGAAGCCATTGCCCTG
CCCTAG
Gene >Ophcf2|07188
ATGGCGGACCAGCAGCAAGTCGTCTTCACTGCCAACGCCCCCACGCGTAAGTCTTCCCCTTGTCAACCGTCTATG
CTCAATCCGGCTCATCCTCGTCTACTCCAGCTCTCGGCCCTTACGTGAGTCGATCCCCCCATCAGTGATCGTAAA
AAAGGTGAAGAAGCCGCCCTAATTCGTACCAGTCTCAAGCCATCAAGACCCCCACGGCCATCTACTGCTCGGGCC
AGATTCCCTTGACCTCCGATGGCGTAATGATCGAGGGCTCCATCGCCGAAAAGACGACGCAGTGCTGCAAGAACC
TTGAGGCCGTCCTGACCGAGGCCGGGTCTTCCCTCCGCAAGATCGTCAAGTTAAACGTCTTTCTGTCCGACATGG
CTCATTTCGCCGTAAGTCCGGTGATTTCTTCCACACTATTGGAAAACCCCTGTCTTACGGATCTTGCCTGTTCGT
CGTCTAGGAGATGAATTCCACGTATGAAAGGTTCTTCCCTCACAAGCCCGCCCGCAGCTGCGTGGCCGTCAAGAC
GCTTCCCAGGAACGTCGACGTCGAGATCGAAGCCATTGCCCTGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail