Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07178
Gene name
Locationscaffold_09:842066..843354
Strand+
Gene length (bp)1288
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain 3.8E-57 107 393
PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain 8.1E-12 17 79

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5903 0.1831 0.0215 0.333 0.223 0.0011 0.1508 0.2545 0.2295 0.5454

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3806
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1698
Ophiocordyceps australis map64 (Brazil) OphauB2|2273
Ophiocordyceps camponoti-floridani Ophcf2|07178 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4801
Ophiocordyceps kimflemingae Ophio5|5218
Ophiocordyceps subramaniannii Hirsu2|7434

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07178
MTTSPNENSAAMVDIKPLLTKLWPVGRDVPADEIANAISHFFTNSISEAQAASLLVALHFNAMDMRADVLAGCAA
VMLQAVSRGSVHDLEAALAHRARPEGRYGGGLCDIVGTGGDSHDTFNVSTTSSILASALLLISKHGNKASTSKSG
SADIVACMKPRAPIVDALRPDTLARVYTATNYGFVFAPLFHTGMRFVAPIRRQLPWRTIFNNIGPLANPLHELIE
ARVIGIGRRDLGPSFREALRTLGCRKALIVCGDEELDEISCAGPTSCWTLCETSPGGEVLSDHFKVEPRDFGLES
HPLSEVSSGKDPKDNAAILTRILQGELAADDPLLDFILINTAALLVVSGICEADTSAMGPGDDGKVVTERGPGGQ
RWKEGVRRARWAIESGEARKQWEAFVNVTHEIGSK*
Coding >Ophcf2|07178
ATGACAACCTCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGGTG
GGGAGAGACGTTCCGGCAGATGAAATCGCCAATGCCATATCCCATTTCTTCACCAACAGCATCAGCGAGGCTCAG
GCGGCGTCGCTGTTGGTGGCGCTTCACTTCAATGCAATGGACATGCGCGCCGACGTCCTTGCTGGCTGTGCCGCC
GTCATGCTGCAAGCCGTATCGCGGGGCTCCGTCCATGACCTCGAGGCAGCGCTGGCCCACCGTGCCAGGCCCGAG
GGCAGATACGGGGGCGGGCTGTGTGACATTGTCGGCACGGGAGGCGACTCGCACGACACCTTCAACGTCAGCACC
ACGTCGTCCATCCTCGCCTCGGCCCTGCTCCTCATATCCAAGCATGGTAACAAGGCCAGCACGTCCAAGTCAGGC
AGCGCCGACATTGTCGCCTGCATGAAGCCGCGAGCCCCCATCGTGGACGCCCTCCGCCCGGATACCCTGGCCCGG
GTCTACACGGCCACCAACTACGGCTTCGTCTTCGCTCCGCTCTTCCATACGGGCATGCGCTTCGTCGCCCCCATC
CGCCGTCAGCTGCCTTGGCGCACCATCTTTAACAATATCGGGCCACTGGCCAACCCGCTCCACGAGCTGATCGAG
GCTCGCGTCATAGGGATAGGCAGGCGAGATCTCGGTCCATCCTTTCGAGAGGCGCTGCGCACTCTCGGCTGTCGC
AAGGCCCTCATCGTCTGCGGCGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGACGCTA
TGCGAGACGTCTCCCGGGGGCGAGGTATTGTCGGACCATTTCAAGGTTGAGCCGCGCGACTTTGGGCTGGAGAGT
CATCCGCTTAGCGAAGTGTCTTCGGGTAAGGACCCAAAGGACAACGCGGCCATCTTGACGCGCATCCTACAGGGA
GAGCTGGCCGCCGACGACCCGCTCCTGGACTTTATCCTGATAAACACGGCGGCTCTTCTGGTTGTCTCCGGCATC
TGCGAGGCCGACACCAGCGCCATGGGGCCCGGAGACGACGGCAAGGTGGTGACGGAGCGTGGGCCGGGTGGGCAG
CGGTGGAAGGAGGGGGTGAGGAGGGCCAGATGGGCCATCGAGAGCGGCGAGGCCCGGAAGCAGTGGGAAGCATTT
GTCAACGTGACGCACGAGATTGGCAGCAAGTGA
Transcript >Ophcf2|07178
ATGACAACCTCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGGTG
GGGAGAGACGTTCCGGCAGATGAAATCGCCAATGCCATATCCCATTTCTTCACCAACAGCATCAGCGAGGCTCAG
GCGGCGTCGCTGTTGGTGGCGCTTCACTTCAATGCAATGGACATGCGCGCCGACGTCCTTGCTGGCTGTGCCGCC
GTCATGCTGCAAGCCGTATCGCGGGGCTCCGTCCATGACCTCGAGGCAGCGCTGGCCCACCGTGCCAGGCCCGAG
GGCAGATACGGGGGCGGGCTGTGTGACATTGTCGGCACGGGAGGCGACTCGCACGACACCTTCAACGTCAGCACC
ACGTCGTCCATCCTCGCCTCGGCCCTGCTCCTCATATCCAAGCATGGTAACAAGGCCAGCACGTCCAAGTCAGGC
AGCGCCGACATTGTCGCCTGCATGAAGCCGCGAGCCCCCATCGTGGACGCCCTCCGCCCGGATACCCTGGCCCGG
GTCTACACGGCCACCAACTACGGCTTCGTCTTCGCTCCGCTCTTCCATACGGGCATGCGCTTCGTCGCCCCCATC
CGCCGTCAGCTGCCTTGGCGCACCATCTTTAACAATATCGGGCCACTGGCCAACCCGCTCCACGAGCTGATCGAG
GCTCGCGTCATAGGGATAGGCAGGCGAGATCTCGGTCCATCCTTTCGAGAGGCGCTGCGCACTCTCGGCTGTCGC
AAGGCCCTCATCGTCTGCGGCGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGACGCTA
TGCGAGACGTCTCCCGGGGGCGAGGTATTGTCGGACCATTTCAAGGTTGAGCCGCGCGACTTTGGGCTGGAGAGT
CATCCGCTTAGCGAAGTGTCTTCGGGTAAGGACCCAAAGGACAACGCGGCCATCTTGACGCGCATCCTACAGGGA
GAGCTGGCCGCCGACGACCCGCTCCTGGACTTTATCCTGATAAACACGGCGGCTCTTCTGGTTGTCTCCGGCATC
TGCGAGGCCGACACCAGCGCCATGGGGCCCGGAGACGACGGCAAGGTGGTGACGGAGCGTGGGCCGGGTGGGCAG
CGGTGGAAGGAGGGGGTGAGGAGGGCCAGATGGGCCATCGAGAGCGGCGAGGCCCGGAAGCAGTGGGAAGCATTT
GTCAACGTGACGCACGAGATTGGCAGCAAGTGA
Gene >Ophcf2|07178
ATGACAACCTCCCCAAATGAGAATAGCGCGGCCATGGTCGACATCAAGCCATTGTTGACCAAGCTCTGGCCGGTG
GGGAGAGACGTTCCGGCAGATGAAATCGCCAATGCCATATCCCATTTCTTCACCAACAGCATCAGCGAGGCTCAG
GCGGCGTCGCTGTTGGTGGCGCTTCACTTCAATGCAATGGACATGCGCGCCGACGTCCTTGCTGGCTGTGCCGCC
GTCATGCTGCAAGCCGTATCGCGGGGCTCCGTCCATGACCTCGAGGCAGCGCTGGCCCACCGTGCCAGGCCCGAG
GGCAGATACGGGGGCGGGCTGGTAAGATTCCTCGTCGGGCCCGGCCGCCTCGGCTGACGGCATGAGCAACGGGCA
GTGTGACATTGTCGGCACGGGAGGCGACTCGCACGACACCTTCAACGTCAGCACCACGTCGTCCATCCTCGCCTC
GGCCCTGCTCCTCATATCCAAGCATGGTAACAAGGCCAGCACGTCCAAGTCAGGCAGCGCCGACATTGTCGCCTG
CATGAAGCCGCGAGCCCCCATCGTGGACGCCCTCCGCCCGGATACCCTGGCCCGGGTCTACACGGCCACCAACTA
CGGCTTCGTCTTCGCTCCGCTCTTCCATACGGGCATGCGCTTCGTCGCCCCCATCCGCCGTCAGCTGCCTTGGCG
CACCATCTTTAACAATATCGGGCCACTGGCCAACCCGCTCCACGAGCTGATCGAGGCTCGCGTCATAGGGATAGG
CAGGCGAGATCTCGGTCCATCCTTTCGAGAGGCGCTGCGCACTCTCGGCTGTCGCAAGGCCCTCATCGTCTGCGG
CGACGAGGAGCTCGACGAGATCAGCTGCGCCGGCCCGACCAGCTGCTGGACGCTATGCGAGACGTCTCCCGGGGG
CGAGGTATTGTCGGACCATTTCAAGGTTGAGCCGCGCGACTTTGGGCTGGAGAGTCATCCGCTTAGCGAAGTGTC
TTCGGGTAAGGACCCAAAGGACAACGCGGCCATCTTGACGCGCATCCTACAGGGAGAGCTGGCCGCCGACGACCC
GCTCCTGGACTTTATCCTGATAAACACGGCGGCTCTTCTGGTTGTCTCCGGCATCTGCGAGGCCGACACCAGCGC
CATGGGGCCCGGAGACGACGGCAAGGTGGTGACGGAGCGTGGGCCGGGTGGGCAGCGGTGGAAGGAGGGGGTGAG
GAGGGCCAGATGGGCCATCGAGAGCGGCGAGGCCCGGAAGCAGTGGGAAGCATTTGTCAACGTGACGCACGAGAT
TGGCAGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail