Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07176
Gene name
Locationscaffold_09:836515..837673
Strand-
Gene length (bp)1158
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00710 Asparaginase Asparaginase, N-terminal 1.0E-51 54 244
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 1.7E-17 268 377

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Plastid Mitochondrial transit peptide 0.189 0.1037 0.043 0.0593 0.891 0.9231 0.0238 0.0382 0.0566 0.0777

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6244
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|897
Ophiocordyceps australis map64 (Brazil) OphauB2|2271
Ophiocordyceps camponoti-floridani Ophcf2|07176 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1673
Ophiocordyceps subramaniannii Hirsu2|7432

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07176
MAARWTTLASSLSREIKGFGFHPARVKRFSLVSAAARRRRMCEEVFPPVGTPPKITVFGTGGTIAGSAVGGGQTT
GYKPGVLSVEGLIDAVPELDTVAELQSKQIINGGSPDITGVDLLRMAQTVNEELKGDTQGVVITHGTDAMEESAF
CLELTVESPKPVVLVGAMRPATAHGADGPMNLLCAVRLAACMRARRRGVMIVLNDRICSAHFTTKTHANSLDSFK
AEEQGYLGMFVNSQPHFYYPACRPLNRWHFDVSGRNPDDGLPQVDVLYGHPDMNQELFRTAVETSQGVVLAAMGG
GCWGTKAGELVASAARDRGFPVVVSRRMASGFVGGAANYGLGDSCIGGGLLDANRCRIQLQLALAMGLDRRAIRR
VFEGNKSVDG*
Coding >Ophcf2|07176
ATGGCTGCGCGTTGGACGACACTGGCTTCCTCCCTGAGCCGGGAGATTAAGGGATTCGGCTTTCATCCGGCTCGG
GTGAAGCGCTTCTCCCTCGTCTCGGCGGCGGCGCGTCGGAGACGGATGTGTGAGGAGGTGTTTCCACCAGTGGGA
ACACCGCCAAAGATCACCGTCTTCGGTACGGGAGGAACCATTGCCGGTTCGGCGGTGGGTGGGGGCCAGACGACG
GGTTACAAGCCGGGAGTGCTGTCAGTGGAAGGGCTGATTGACGCGGTGCCGGAGCTGGACACGGTGGCAGAGCTC
CAGAGCAAGCAGATAATCAACGGGGGAAGCCCGGACATCACGGGGGTGGACCTGCTGCGGATGGCGCAGACGGTC
AATGAGGAGCTCAAGGGCGACACGCAGGGCGTCGTCATCACTCACGGCACCGACGCCATGGAGGAGTCGGCCTTT
TGCCTCGAGCTGACGGTTGAATCGCCAAAGCCGGTGGTGCTGGTAGGGGCCATGCGTCCGGCTACTGCGCACGGG
GCAGACGGACCCATGAACCTGCTGTGCGCCGTCCGGCTGGCAGCCTGCATGAGGGCGAGACGTCGAGGAGTCATG
ATTGTGCTCAACGATCGCATCTGCTCGGCGCACTTCACCACCAAGACTCACGCCAACTCGCTCGACTCGTTCAAG
GCAGAGGAGCAGGGATATCTGGGCATGTTTGTCAACTCGCAGCCTCATTTCTACTACCCGGCGTGCCGACCGCTC
AACCGGTGGCACTTTGACGTTTCCGGACGGAATCCCGACGACGGACTTCCGCAGGTGGACGTTCTGTACGGCCAT
CCGGACATGAACCAGGAGCTGTTCCGTACGGCGGTCGAGACGTCGCAAGGGGTGGTGCTGGCGGCCATGGGCGGT
GGCTGTTGGGGCACCAAGGCAGGCGAGTTGGTGGCCTCTGCGGCGAGAGATCGAGGCTTCCCCGTGGTTGTGAGC
CGGAGGATGGCGTCGGGCTTCGTCGGCGGTGCGGCCAACTACGGTCTGGGCGACAGCTGCATCGGCGGCGGCCTC
CTCGACGCCAATCGGTGTCGCATCCAGCTGCAGCTGGCCTTGGCGATGGGGTTGGATCGCCGGGCCATCAGGCGA
GTGTTTGAGGGCAACAAGAGCGTCGATGGGTGA
Transcript >Ophcf2|07176
ATGGCTGCGCGTTGGACGACACTGGCTTCCTCCCTGAGCCGGGAGATTAAGGGATTCGGCTTTCATCCGGCTCGG
GTGAAGCGCTTCTCCCTCGTCTCGGCGGCGGCGCGTCGGAGACGGATGTGTGAGGAGGTGTTTCCACCAGTGGGA
ACACCGCCAAAGATCACCGTCTTCGGTACGGGAGGAACCATTGCCGGTTCGGCGGTGGGTGGGGGCCAGACGACG
GGTTACAAGCCGGGAGTGCTGTCAGTGGAAGGGCTGATTGACGCGGTGCCGGAGCTGGACACGGTGGCAGAGCTC
CAGAGCAAGCAGATAATCAACGGGGGAAGCCCGGACATCACGGGGGTGGACCTGCTGCGGATGGCGCAGACGGTC
AATGAGGAGCTCAAGGGCGACACGCAGGGCGTCGTCATCACTCACGGCACCGACGCCATGGAGGAGTCGGCCTTT
TGCCTCGAGCTGACGGTTGAATCGCCAAAGCCGGTGGTGCTGGTAGGGGCCATGCGTCCGGCTACTGCGCACGGG
GCAGACGGACCCATGAACCTGCTGTGCGCCGTCCGGCTGGCAGCCTGCATGAGGGCGAGACGTCGAGGAGTCATG
ATTGTGCTCAACGATCGCATCTGCTCGGCGCACTTCACCACCAAGACTCACGCCAACTCGCTCGACTCGTTCAAG
GCAGAGGAGCAGGGATATCTGGGCATGTTTGTCAACTCGCAGCCTCATTTCTACTACCCGGCGTGCCGACCGCTC
AACCGGTGGCACTTTGACGTTTCCGGACGGAATCCCGACGACGGACTTCCGCAGGTGGACGTTCTGTACGGCCAT
CCGGACATGAACCAGGAGCTGTTCCGTACGGCGGTCGAGACGTCGCAAGGGGTGGTGCTGGCGGCCATGGGCGGT
GGCTGTTGGGGCACCAAGGCAGGCGAGTTGGTGGCCTCTGCGGCGAGAGATCGAGGCTTCCCCGTGGTTGTGAGC
CGGAGGATGGCGTCGGGCTTCGTCGGCGGTGCGGCCAACTACGGTCTGGGCGACAGCTGCATCGGCGGCGGCCTC
CTCGACGCCAATCGGTGTCGCATCCAGCTGCAGCTGGCCTTGGCGATGGGGTTGGATCGCCGGGCCATCAGGCGA
GTGTTTGAGGGCAACAAGAGCGTCGATGGGTGA
Gene >Ophcf2|07176
ATGGCTGCGCGTTGGACGACACTGGCTTCCTCCCTGAGCCGGGAGATTAAGGGATTCGGCTTTCATCCGGCTCGG
GTGAAGCGCTTCTCCCTCGTCTCGGCGGCGGCGCGTCGGAGACGGATGTGTGAGGAGGTGTTTCCACCAGTGGGA
ACACCGCCAAAGATCACCGTCTTCGGTACGGGAGGAACCATTGCCGGTTCGGCGGTGGGTGGGGGCCAGACGACG
GGTTACAAGCCGGGAGTGCTGTCAGTGGAAGGGCTGATTGACGCGGTGCCGGAGCTGGACACGGTGGCAGAGCTC
CAGAGCAAGCAGATAATCAACGGGGGAAGCCCGGACATCACGGGGGTGGACCTGCTGCGGATGGCGCAGACGGTC
AATGAGGAGCTCAAGGGCGACACGCAGGGCGTCGTCATCACTCACGGCACCGACGCCATGGAGGAGTCGGCCTTT
TGCCTCGAGCTGACGGTTGAATCGCCAAAGCCGGTGGTGCTGGTAGGGGCCATGCGTCCGGCTACTGCGCACGGG
GCAGACGGACCCATGAACCTGCTGTGCGCCGTCCGGCTGGCAGCCTGCATGAGGGCGAGACGTCGAGGAGTCATG
ATTGTGCTCAACGATCGCATCTGCTCGGCGCACTTCACCACCAAGACTCACGCCAACTCGCTCGACTCGTTCAAG
GCAGAGGAGCAGGGATATCTGGGCATGTTTGTCAACTCGCAGCCTCATTTCTACTACCCGGCGTGCCGACCGCTC
AACCGGTGGCACTTTGACGTTTCCGGACGGAATCCCGACGACGGACTTCCGCAGGTGGACGTTCTGTACGGCCAT
CCGGACATGAACCAGGAGCTGTTCCGTACGGCGGTCGAGACGTCGCAAGGGGTGGTGCTGGCGGCCATGGGCGGT
GGCTGTTGGGGCACCAAGGCAGGCGAGTTGGTGGCCTCTGCGGCGAGAGATCGAGGCTTCCCCGTGGTTGTGAGC
CGGAGGATGGCGTCGGGCTTCGTCGGCGGTGCGGCCAACTACGGTCTGGGCGACAGCTGCATCGGCGGCGGCCTC
CTCGACGCCAATCGGTGTCGCATCCAGCTGCAGCTGGCCTTGGCGATGGGGTTGGATCGCCGGGCCATCAGGCGA
GTGTTTGAGGGCAACAAGAGCGTCGATGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail