Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07175
Gene name
Locationscaffold_09:831089..835380
Strand-
Gene length (bp)4291
Transcript length (bp)4152
Coding sequence length (bp)4152
Protein length (aa) 1384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 6.1E-65 1069 1315
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.6E-22 93 149
PF13246 Cation_ATPase Cation transport ATPase (P-type) 6.0E-10 605 688
PF00122 E1-E2_ATPase E1-E2 ATPase 1.3E-08 234 443

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 139 161 22
2 382 404 22
3 424 443 19
4 1183 1205 22
5 1215 1237 22
6 1244 1263 19
7 1290 1312 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07175
MSSVSLPAEKAPSLLVSSPQRRHLYDVDDNDDDHDHGPRLSMRYRLWTAVKTVYQANVVPLILRNKHVDASKHGR
HIPLAIEHHRPLVDASRGHAYLSNNVRTSRYTIWDFIPKQLFFQFSRVGNFYFLCVGVPQMIPGLSTTGSFTTIL
PLFFFVLLTVAKEGYDDYRRHILDTVENANYATVLGRHDPDVGHAKSPRSWRRWNPFRTESTSQPRPAPIDEYLG
VRWVPSRWSHVKVGDVVLLSRDEPVPADLVLLHSDGENGVAYIDTMALDGETSLKTKQVCHALHGCSSIQGIAQC
PAEFVVEDPNPDLFNFEGRVTVGGETVPLTLSHVVYRGSVLRNTRRAVGLVVNTGEECKVRMNSNQHPHAKRPAL
EKIVNKVVFSLAVYVVVLSVGVSMGYVHFRAVYEKHAWFLDGATVPFHQIIIAFVIMFNNVVPLSLYISLEIVKV
GQLLLLNSDIDMYDAETDTPARCNTNTIMENLGQIGYVFSDKTGTLTDNVMKFRKLSVAGTVWLHATDLEEDGDH
GKPPTLACRSSLGRRPSSRWRSTGRPDHVQPEVNTAHLLEHMRHRPHSAFSRAARDLLLAVAICHTCLPEVKHGR
IEFQASSPDELALVRAAQELGFGVTQRTSQSITVQVPRPNGQSESMVFQILDVIEFSSARKRMSVVVRYPDGRIS
IVCKGADSVVLPRLRLSKLAKQRAHEVRKSAELEREMHRRSEQQESRNSFGGRRSMTVRRNVEAVADGGGGGSAA
AAAATATGWRSLASRSRSFEVHNLARSSVDRPRASAVARRGVSLDVSCEQGSTTASHPRPQHDRLDFLNDAALYD
ESEVFSRCFKHLDDFATEGLRTLVYAQRFVSETEYGGWKEMYDEATTSLDDRQQMIEQAGELMETGLELVGATAI
EDKLQRGVPEAIDRLRRANIKIWMLTGDKRETAINIAHSARICRLASDLYVLDADRSPLRTQLAAVAEDLQAGSV
HSVVVIDGQTLAVVEKSAELSRRFFDLALLVDSVICCRASPAQKAMLVRAVRSRCRHEKHGLTLAIGDGANDLAM
IQASHVGVGISGKEGLQAARVADYAIGQFRFLQRLLLVHGRWNYVRTAKFVLCTFWKEMFFYLPTAVYQRYSGYS
GTSLYQEVSLTVFNTLFTSLCTICMGIWEQDLSADTVLAVPELYVYGQRGSGLGMAKYLRWMAVAVVEGLAVWYG
VWAGYGRASPSDEGLYALGTLVFTVGVLWINWKLFILETHYKPCVILASFFLTTMGWFAWLAFLDGVYAPNPSGP
YLIHHTLRQSWGMDITWWSTLFLTLALVSLIELAVGIVTRHGHHLVPHMLSPNNRHAATTSPYSLAENVEEWDVA
LWQELEQDPVIRARLYRLARDGDCDDEAALLSA*
Coding >Ophcf2|07175
ATGTCTTCTGTCTCGTTGCCTGCTGAAAAGGCCCCCTCGCTTCTCGTCTCGAGTCCGCAGCGTCGTCACCTCTAT
GACGTTGACGATAATGATGACGACCATGATCATGGTCCCCGTCTGTCGATGCGATACCGCCTCTGGACCGCTGTC
AAGACCGTCTATCAAGCCAATGTCGTCCCGCTGATATTGCGAAACAAGCATGTCGATGCCTCGAAGCATGGCAGA
CACATTCCTCTCGCTATCGAGCATCACCGTCCGCTCGTCGATGCCAGTCGCGGCCACGCCTATCTTTCCAACAAT
GTCCGCACCTCTCGCTATACCATATGGGACTTTATACCCAAGCAACTCTTCTTTCAGTTTTCCCGCGTTGGAAAC
TTTTACTTTCTCTGCGTTGGCGTCCCCCAGATGATACCGGGCCTATCTACGACTGGGTCCTTCACTACTATCCTA
CCGCTGTTCTTCTTCGTCCTCCTCACCGTCGCCAAGGAGGGCTACGACGACTACAGACGTCATATCTTGGATACG
GTGGAGAATGCGAACTATGCCACCGTCCTCGGCCGTCATGACCCGGATGTCGGCCACGCAAAATCGCCTCGTTCT
TGGCGACGCTGGAACCCCTTCCGTACCGAGTCCACCAGCCAACCGAGGCCGGCTCCCATTGACGAGTATCTCGGC
GTCCGATGGGTGCCTTCTCGATGGAGTCACGTCAAGGTCGGCGACGTCGTCTTGTTATCTCGCGATGAACCCGTG
CCTGCCGACTTGGTTCTTCTTCACAGCGATGGCGAGAACGGAGTCGCTTACATCGACACCATGGCCCTAGACGGC
GAGACTAGCCTCAAGACGAAGCAGGTCTGCCATGCGCTACACGGCTGCAGCTCCATCCAAGGCATCGCTCAATGC
CCAGCCGAGTTTGTCGTCGAGGATCCAAACCCGGACCTCTTCAACTTTGAGGGCCGCGTCACTGTCGGCGGCGAG
ACGGTGCCCCTGACTCTCAGTCATGTCGTCTACCGTGGCAGCGTCTTACGAAATACAAGGCGAGCCGTCGGTCTT
GTCGTCAACACGGGCGAGGAGTGCAAGGTCCGGATGAACTCCAACCAACACCCGCACGCCAAGCGGCCGGCCCTG
GAGAAGATTGTCAACAAGGTAGTCTTTAGCCTTGCCGTCTACGTTGTCGTCCTCTCCGTCGGCGTCTCAATGGGC
TACGTCCACTTCCGCGCCGTCTATGAGAAGCATGCCTGGTTCCTCGACGGCGCCACAGTCCCGTTTCATCAGATC
ATCATCGCCTTCGTCATCATGTTCAACAATGTCGTGCCGCTATCGCTGTACATCTCGCTGGAGATTGTAAAGGTC
GGCCAGCTTCTCCTGCTCAACTCGGATATCGACATGTACGACGCCGAGACGGACACGCCTGCGCGGTGCAACACC
AACACCATTATGGAAAATCTCGGTCAGATCGGCTACGTCTTCTCCGACAAGACGGGCACCCTGACGGACAACGTC
ATGAAGTTTCGCAAGCTTAGCGTCGCCGGTACCGTCTGGCTTCATGCCACGGACCTGGAGGAGGACGGAGACCAC
GGGAAGCCGCCGACGCTGGCATGTCGCTCGTCGCTGGGCCGGAGACCGTCTTCGCGGTGGCGATCGACGGGCCGG
CCAGACCACGTCCAGCCCGAGGTCAACACGGCGCATCTGCTGGAGCACATGAGGCACAGGCCGCACTCGGCCTTT
TCCAGGGCGGCCAGAGACCTCTTGCTGGCCGTCGCCATCTGCCACACCTGTCTGCCCGAGGTCAAGCACGGACGG
ATCGAGTTCCAGGCGTCTTCGCCCGATGAGCTGGCCCTGGTGAGGGCGGCTCAGGAGCTCGGCTTCGGCGTCACG
CAGCGGACGTCGCAGAGCATAACGGTACAGGTGCCGCGTCCCAACGGCCAGAGCGAGTCGATGGTATTTCAGATT
CTCGACGTCATCGAGTTCAGCAGCGCGCGAAAGAGGATGTCGGTCGTGGTTCGGTATCCGGACGGGCGCATCTCC
ATCGTCTGCAAGGGCGCTGATTCCGTCGTCCTGCCCCGGCTGAGGCTGTCGAAGCTGGCCAAGCAGAGAGCGCAC
GAGGTCCGCAAGAGCGCCGAACTGGAGCGCGAGATGCATAGACGCAGCGAGCAGCAGGAGTCGCGCAATAGCTTT
GGTGGGAGGCGAAGCATGACGGTGAGGCGGAACGTTGAAGCCGTTGCTGATGGTGGTGGTGGTGGTTCAGCTGCT
GCTGCTGCTGCTACTGCTACGGGCTGGCGTTCGCTGGCGAGCAGAAGTAGATCCTTTGAGGTTCACAACTTGGCT
CGCTCGTCCGTTGACCGGCCTCGGGCTTCGGCCGTGGCCCGGAGAGGAGTCTCGCTCGATGTGTCCTGTGAGCAG
GGCTCGACGACGGCGTCTCATCCGCGGCCTCAGCACGACCGCCTCGACTTCCTCAACGATGCCGCCCTGTACGAT
GAGTCCGAGGTCTTCAGCCGCTGTTTCAAGCATCTCGACGACTTCGCCACCGAGGGCCTCCGGACTCTCGTGTAC
GCTCAGAGGTTCGTATCGGAGACGGAGTATGGCGGGTGGAAGGAGATGTATGACGAGGCGACTACGAGCCTCGAC
GACCGGCAGCAGATGATAGAGCAGGCGGGCGAGTTGATGGAGACGGGCCTCGAGCTTGTCGGCGCCACGGCCATC
GAGGACAAGCTGCAGAGGGGCGTCCCGGAGGCCATTGACAGGCTTCGGCGGGCCAATATCAAGATCTGGATGCTG
ACGGGCGACAAGCGGGAGACTGCCATAAACATTGCCCATTCAGCCCGTATCTGTCGGCTGGCGTCAGATCTATAC
GTGCTCGACGCCGACCGGAGCCCCCTTCGGACGCAGCTTGCGGCGGTGGCCGAGGATCTACAGGCCGGCTCGGTC
CACAGCGTCGTCGTCATCGACGGCCAGACGCTGGCGGTGGTGGAGAAGTCGGCCGAACTGTCGAGGCGTTTCTTC
GACCTGGCCCTGCTCGTCGACTCGGTCATCTGCTGCCGAGCCTCTCCGGCACAAAAGGCGATGCTGGTACGGGCC
GTGAGAAGCCGATGCCGACACGAGAAGCACGGTCTGACGCTGGCCATAGGCGACGGCGCAAACGACCTGGCCATG
ATCCAAGCCAGTCACGTCGGCGTCGGCATCTCGGGAAAGGAGGGCCTACAGGCGGCGCGTGTGGCCGATTACGCC
ATCGGTCAGTTCCGCTTCCTTCAGCGACTCCTCCTCGTCCACGGCCGCTGGAACTACGTGCGAACGGCCAAGTTC
GTCCTCTGCACCTTTTGGAAGGAAATGTTCTTCTACCTCCCCACGGCCGTCTACCAGCGATACAGCGGCTACAGC
GGCACCTCGCTCTACCAAGAGGTCAGCCTGACCGTCTTCAACACGCTCTTCACCAGCCTGTGCACCATCTGCATG
GGCATCTGGGAGCAGGACCTCAGCGCCGACACGGTGCTTGCCGTTCCCGAGCTGTACGTCTACGGCCAGCGGGGA
TCGGGTCTCGGCATGGCCAAGTATCTGCGCTGGATGGCCGTTGCCGTCGTCGAGGGCCTGGCTGTCTGGTACGGC
GTCTGGGCGGGATACGGTCGTGCCTCTCCCTCGGATGAAGGGCTGTACGCGCTGGGGACGCTGGTATTCACCGTG
GGCGTCCTGTGGATCAACTGGAAGCTATTCATCCTCGAAACACACTACAAACCGTGCGTCATCCTCGCCAGCTTC
TTCCTCACGACCATGGGCTGGTTCGCCTGGCTCGCCTTCCTGGACGGCGTCTACGCCCCCAATCCCTCGGGCCCC
TACCTCATCCACCACACCCTCCGCCAATCCTGGGGCATGGATATAACCTGGTGGTCCACCCTCTTCCTCACCCTC
GCCCTCGTCTCCCTCATCGAACTAGCCGTCGGCATCGTGACGAGACACGGACACCACCTCGTACCGCACATGTTG
TCCCCCAACAACCGCCATGCCGCCACCACCTCGCCCTATTCTCTGGCCGAGAATGTCGAGGAGTGGGACGTTGCC
TTGTGGCAGGAACTCGAACAGGATCCCGTGATTCGCGCCAGGCTTTACCGTCTTGCTCGTGATGGGGATTGTGAT
GATGAGGCTGCTTTGCTATCTGCTTGA
Transcript >Ophcf2|07175
ATGTCTTCTGTCTCGTTGCCTGCTGAAAAGGCCCCCTCGCTTCTCGTCTCGAGTCCGCAGCGTCGTCACCTCTAT
GACGTTGACGATAATGATGACGACCATGATCATGGTCCCCGTCTGTCGATGCGATACCGCCTCTGGACCGCTGTC
AAGACCGTCTATCAAGCCAATGTCGTCCCGCTGATATTGCGAAACAAGCATGTCGATGCCTCGAAGCATGGCAGA
CACATTCCTCTCGCTATCGAGCATCACCGTCCGCTCGTCGATGCCAGTCGCGGCCACGCCTATCTTTCCAACAAT
GTCCGCACCTCTCGCTATACCATATGGGACTTTATACCCAAGCAACTCTTCTTTCAGTTTTCCCGCGTTGGAAAC
TTTTACTTTCTCTGCGTTGGCGTCCCCCAGATGATACCGGGCCTATCTACGACTGGGTCCTTCACTACTATCCTA
CCGCTGTTCTTCTTCGTCCTCCTCACCGTCGCCAAGGAGGGCTACGACGACTACAGACGTCATATCTTGGATACG
GTGGAGAATGCGAACTATGCCACCGTCCTCGGCCGTCATGACCCGGATGTCGGCCACGCAAAATCGCCTCGTTCT
TGGCGACGCTGGAACCCCTTCCGTACCGAGTCCACCAGCCAACCGAGGCCGGCTCCCATTGACGAGTATCTCGGC
GTCCGATGGGTGCCTTCTCGATGGAGTCACGTCAAGGTCGGCGACGTCGTCTTGTTATCTCGCGATGAACCCGTG
CCTGCCGACTTGGTTCTTCTTCACAGCGATGGCGAGAACGGAGTCGCTTACATCGACACCATGGCCCTAGACGGC
GAGACTAGCCTCAAGACGAAGCAGGTCTGCCATGCGCTACACGGCTGCAGCTCCATCCAAGGCATCGCTCAATGC
CCAGCCGAGTTTGTCGTCGAGGATCCAAACCCGGACCTCTTCAACTTTGAGGGCCGCGTCACTGTCGGCGGCGAG
ACGGTGCCCCTGACTCTCAGTCATGTCGTCTACCGTGGCAGCGTCTTACGAAATACAAGGCGAGCCGTCGGTCTT
GTCGTCAACACGGGCGAGGAGTGCAAGGTCCGGATGAACTCCAACCAACACCCGCACGCCAAGCGGCCGGCCCTG
GAGAAGATTGTCAACAAGGTAGTCTTTAGCCTTGCCGTCTACGTTGTCGTCCTCTCCGTCGGCGTCTCAATGGGC
TACGTCCACTTCCGCGCCGTCTATGAGAAGCATGCCTGGTTCCTCGACGGCGCCACAGTCCCGTTTCATCAGATC
ATCATCGCCTTCGTCATCATGTTCAACAATGTCGTGCCGCTATCGCTGTACATCTCGCTGGAGATTGTAAAGGTC
GGCCAGCTTCTCCTGCTCAACTCGGATATCGACATGTACGACGCCGAGACGGACACGCCTGCGCGGTGCAACACC
AACACCATTATGGAAAATCTCGGTCAGATCGGCTACGTCTTCTCCGACAAGACGGGCACCCTGACGGACAACGTC
ATGAAGTTTCGCAAGCTTAGCGTCGCCGGTACCGTCTGGCTTCATGCCACGGACCTGGAGGAGGACGGAGACCAC
GGGAAGCCGCCGACGCTGGCATGTCGCTCGTCGCTGGGCCGGAGACCGTCTTCGCGGTGGCGATCGACGGGCCGG
CCAGACCACGTCCAGCCCGAGGTCAACACGGCGCATCTGCTGGAGCACATGAGGCACAGGCCGCACTCGGCCTTT
TCCAGGGCGGCCAGAGACCTCTTGCTGGCCGTCGCCATCTGCCACACCTGTCTGCCCGAGGTCAAGCACGGACGG
ATCGAGTTCCAGGCGTCTTCGCCCGATGAGCTGGCCCTGGTGAGGGCGGCTCAGGAGCTCGGCTTCGGCGTCACG
CAGCGGACGTCGCAGAGCATAACGGTACAGGTGCCGCGTCCCAACGGCCAGAGCGAGTCGATGGTATTTCAGATT
CTCGACGTCATCGAGTTCAGCAGCGCGCGAAAGAGGATGTCGGTCGTGGTTCGGTATCCGGACGGGCGCATCTCC
ATCGTCTGCAAGGGCGCTGATTCCGTCGTCCTGCCCCGGCTGAGGCTGTCGAAGCTGGCCAAGCAGAGAGCGCAC
GAGGTCCGCAAGAGCGCCGAACTGGAGCGCGAGATGCATAGACGCAGCGAGCAGCAGGAGTCGCGCAATAGCTTT
GGTGGGAGGCGAAGCATGACGGTGAGGCGGAACGTTGAAGCCGTTGCTGATGGTGGTGGTGGTGGTTCAGCTGCT
GCTGCTGCTGCTACTGCTACGGGCTGGCGTTCGCTGGCGAGCAGAAGTAGATCCTTTGAGGTTCACAACTTGGCT
CGCTCGTCCGTTGACCGGCCTCGGGCTTCGGCCGTGGCCCGGAGAGGAGTCTCGCTCGATGTGTCCTGTGAGCAG
GGCTCGACGACGGCGTCTCATCCGCGGCCTCAGCACGACCGCCTCGACTTCCTCAACGATGCCGCCCTGTACGAT
GAGTCCGAGGTCTTCAGCCGCTGTTTCAAGCATCTCGACGACTTCGCCACCGAGGGCCTCCGGACTCTCGTGTAC
GCTCAGAGGTTCGTATCGGAGACGGAGTATGGCGGGTGGAAGGAGATGTATGACGAGGCGACTACGAGCCTCGAC
GACCGGCAGCAGATGATAGAGCAGGCGGGCGAGTTGATGGAGACGGGCCTCGAGCTTGTCGGCGCCACGGCCATC
GAGGACAAGCTGCAGAGGGGCGTCCCGGAGGCCATTGACAGGCTTCGGCGGGCCAATATCAAGATCTGGATGCTG
ACGGGCGACAAGCGGGAGACTGCCATAAACATTGCCCATTCAGCCCGTATCTGTCGGCTGGCGTCAGATCTATAC
GTGCTCGACGCCGACCGGAGCCCCCTTCGGACGCAGCTTGCGGCGGTGGCCGAGGATCTACAGGCCGGCTCGGTC
CACAGCGTCGTCGTCATCGACGGCCAGACGCTGGCGGTGGTGGAGAAGTCGGCCGAACTGTCGAGGCGTTTCTTC
GACCTGGCCCTGCTCGTCGACTCGGTCATCTGCTGCCGAGCCTCTCCGGCACAAAAGGCGATGCTGGTACGGGCC
GTGAGAAGCCGATGCCGACACGAGAAGCACGGTCTGACGCTGGCCATAGGCGACGGCGCAAACGACCTGGCCATG
ATCCAAGCCAGTCACGTCGGCGTCGGCATCTCGGGAAAGGAGGGCCTACAGGCGGCGCGTGTGGCCGATTACGCC
ATCGGTCAGTTCCGCTTCCTTCAGCGACTCCTCCTCGTCCACGGCCGCTGGAACTACGTGCGAACGGCCAAGTTC
GTCCTCTGCACCTTTTGGAAGGAAATGTTCTTCTACCTCCCCACGGCCGTCTACCAGCGATACAGCGGCTACAGC
GGCACCTCGCTCTACCAAGAGGTCAGCCTGACCGTCTTCAACACGCTCTTCACCAGCCTGTGCACCATCTGCATG
GGCATCTGGGAGCAGGACCTCAGCGCCGACACGGTGCTTGCCGTTCCCGAGCTGTACGTCTACGGCCAGCGGGGA
TCGGGTCTCGGCATGGCCAAGTATCTGCGCTGGATGGCCGTTGCCGTCGTCGAGGGCCTGGCTGTCTGGTACGGC
GTCTGGGCGGGATACGGTCGTGCCTCTCCCTCGGATGAAGGGCTGTACGCGCTGGGGACGCTGGTATTCACCGTG
GGCGTCCTGTGGATCAACTGGAAGCTATTCATCCTCGAAACACACTACAAACCGTGCGTCATCCTCGCCAGCTTC
TTCCTCACGACCATGGGCTGGTTCGCCTGGCTCGCCTTCCTGGACGGCGTCTACGCCCCCAATCCCTCGGGCCCC
TACCTCATCCACCACACCCTCCGCCAATCCTGGGGCATGGATATAACCTGGTGGTCCACCCTCTTCCTCACCCTC
GCCCTCGTCTCCCTCATCGAACTAGCCGTCGGCATCGTGACGAGACACGGACACCACCTCGTACCGCACATGTTG
TCCCCCAACAACCGCCATGCCGCCACCACCTCGCCCTATTCTCTGGCCGAGAATGTCGAGGAGTGGGACGTTGCC
TTGTGGCAGGAACTCGAACAGGATCCCGTGATTCGCGCCAGGCTTTACCGTCTTGCTCGTGATGGGGATTGTGAT
GATGAGGCTGCTTTGCTATCTGCTTGA
Gene >Ophcf2|07175
ATGTCTTCTGTCTCGTTGCCTGCTGAAAAGGCCCCCTCGCTTCTCGTCTCGAGTCCGCAGCGTCGTCACCTCTAT
GACGTTGACGATAATGATGACGACCATGATCATGGTCCCCGTCTGTCGATGCGATACCGCCTCTGGACCGCTGTC
AAGACCGTCTATCAAGCCAATGTCGTCCCGCTGATATTGCGAAACAAGCATGTCGATGCCTCGAAGCATGGCAGA
CACATTCCTCTCGCTATCGAGCATCACCGTCCGCTCGTCGATGCCAGTCGCGGCCACGCCTATCTTTCCAACAAT
GTCCGCACCTCTCGCTATACCATATGGGACTTTATACCCAAGCAACTCTTCTTTCAGTTTTCCCGCGTTGGAAAC
TTTTACTTTCTCTGCGTTGGCGTCCCCCAGATGGTATGTGAAAACTTCTTTCTCTCTCTGACTCTTGTCTTGTCC
CGTTTCTCGAGCTGACCAAGCGCCAGATACCGGGCCTATCTACGACTGGGTCCTTCACTACTATCCTACCGCTGT
TCTTCTTCGTCCTCCTCACCGTCGCCAAGGAGGGCTACGACGACTACAGACGTCATATCTTGGATACGGTGGAGA
ATGCGAACTATGCCACCGTCCTCGGCCGTCATGACCCGGATGTCGGCCACGCAAAATCGCCTCGTTCTTGGCGAC
GCTGGAACCCCTTCCGTACCGAGTCCACCAGCCAACCGAGGCCGGCTCCCATTGACGAGTATCTCGGCGTCCGAT
GGGTGCCTTCTCGATGGAGTCACGTCAAGGTCGGCGACGTCGTCTTGTTATCTCGCGATGAACCCGTGCCTGCCG
ACTTGGTTCTTCTTCACAGCGATGGCGAGAACGGAGTCGCTTACATCGACACCATGGCCCTAGACGGCGAGACTA
GCCTCAAGACGAAGCAGGTCTGCCATGCGCTACACGGCTGCAGCTCCATCCAAGGCATCGCTCAATGCCCAGCCG
AGTTTGTCGTCGAGGATCCAAACCCGGACCTCTTCAACTTTGAGGGCCGCGTCACTGTCGGCGGCGAGACGGTGC
CCCTGACTCTCAGTCATGTCGTCTACCGTGGCAGCGTCTTACGAAATACAAGGCGAGCCGTCGGTCTTGTCGTCA
ACACGGGCGAGGAGTGCAAGGTCCGGATGAACTCCAACCAACACCCGCACGCCAAGCGGCCGGCCCTGGAGAAGA
TTGTCAACAAGGTAGTCTTTAGCCTTGCCGTCTACGTTGTCGTCCTCTCCGTCGGCGTCTCAATGGGCTACGTCC
ACTTCCGCGCCGTCTATGAGAAGCATGCCTGGTTCCTCGACGGCGCCACAGTCCCGTTTCATCAGATCATCATCG
CCTTCGTCATCATGTTCAACAATGTCGTGCCGCTATCGCTGTACATCTCGCTGGAGATTGTAAAGGTCGGCCAGC
TTCTCCTGCTCAACTCGGATATCGACATGTACGACGCCGAGACGGACACGCCTGCGCGGTGCAACACCAACACCA
TTATGGAAAATCTCGGTCAGATCGGCTACGTCTTCTCCGACAAGACGGGCACCCTGACGGACAACGTCATGAAGT
TTCGCAAGCTTAGCGTCGCCGGTACCGTCTGGCTTCATGCCACGGACCTGGAGGAGGACGGAGACCACGGGAAGC
CGCCGACGCTGGCATGTCGCTCGTCGCTGGGCCGGAGACCGTCTTCGCGGTGGCGATCGACGGGCCGGCCAGACC
ACGTCCAGCCCGAGGTCAACACGGCGCATCTGCTGGAGCACATGAGGCACAGGCCGCACTCGGCCTTTTCCAGGG
CGGCCAGAGACCTCTTGCTGGCCGTCGCCATCTGCCACACCTGTCTGCCCGAGGTCAAGCACGGACGGATCGAGT
TCCAGGCGTCTTCGCCCGATGAGCTGGCCCTGGTGAGGGCGGCTCAGGAGCTCGGCTTCGGCGTCACGCAGCGGA
CGTCGCAGAGCATAACGGTACAGGTGCCGCGTCCCAACGGCCAGAGCGAGTCGATGGTATTTCAGATTCTCGACG
TCATCGAGTTCAGCAGCGCGCGAAAGAGGATGTCGGTCGTGGTTCGGTATCCGGACGGGCGCATCTCCATCGTCT
GCAAGGGCGCTGATTCCGTCGTCCTGCCCCGGCTGAGGCTGTCGAAGCTGGCCAAGCAGAGAGCGCACGAGGTCC
GCAAGAGCGCCGAACTGGAGCGCGAGATGCATAGACGCAGCGAGCAGCAGGAGTCGCGCAATAGCTTTGGTGGGA
GGCGAAGCATGACGGTGAGGCGGAACGTTGAAGCCGTTGCTGATGGTGGTGGTGGTGGTTCAGCTGCTGCTGCTG
CTGCTACTGCTACGGGCTGGCGTTCGCTGGCGAGCAGAAGTAGATCCTTTGAGGTTCACAACTTGGCTCGCTCGT
CCGTTGACCGGCCTCGGGCTTCGGCCGTGGCCCGGAGAGGAGTCTCGCTCGATGTGTCCTGTGAGCAGGGCTCGA
CGACGGCGTCTCATCCGCGGCCTCAGCACGACCGCCTCGACTTCCTCAACGATGCCGCCCTGTACGATGAGTCCG
AGGTCTTCAGCCGCTGTTTCAAGCATCTCGACGACTTCGCCACCGAGGGCCTCCGGACTCTCGTGTACGCTCAGA
GGTTCGTATCGGAGACGGAGTATGGCGGGTGGAAGGAGATGTATGACGAGGCGACTACGAGCCTCGACGACCGGC
AGCAGATGATAGAGCAGGCGGGCGAGTTGATGGAGACGGGCCTCGAGCTTGTCGGCGCCACGGCCATCGAGGACA
AGCTGCAGAGGGGCGTCCCGGAGGCCATTGACAGGCTTCGGCGGGCCAATATCAAGATCTGGATGCTGACGGGCG
ACAAGCGGGAGACTGCCATAAACATTGCCCATTCAGCCCGTATCTGTCGGCTGGCGTCAGATCTATACGTGCTCG
ACGCCGACCGGAGCCCCCTTCGGACGCAGCTTGCGGCGGTGGCCGAGGATCTACAGGCCGGCTCGGTCCACAGCG
TCGTCGTCATCGACGGCCAGACGCTGGCGGTGGTGGAGAAGTCGGCCGAACTGTCGAGGCGTTTCTTCGACCTGG
CCCTGCTCGTCGACTCGGTCATCTGCTGCCGAGCCTCTCCGGCACAAAAGGCGATGCTGGTACGGGCCGTGAGAA
GCCGATGCCGACACGAGAAGCACGGTCTGACGCTGGCCATAGGCGACGGCGCAAACGACCTGGCCATGATCCAAG
CCAGTCACGTCGGCGTCGGCATCTCGGGAAAGGAGGGCCTACAGGCGGCGCGTGTGGCCGATTACGCCATCGGTC
AGTTCCGCTTCCTTCAGCGACTCCTCCTCGTCCACGGCCGCTGGAACTACGTGCGAACGGCCAAGTTCGTCCTCT
GCACCTTTTGGAAGGAAATGTTCTTCTACCTCCCCACGGCCGTCTACCAGCGATACAGCGGCTACAGCGGCACCT
CGCTCTACCAAGAGGTCAGCCTGACCGTCTTCAACACGCTCTTCACCAGCCTGTGCACCATCTGCATGGGCATCT
GGGAGCAGGACCTCAGCGCCGACACGGTGCTTGCCGTTCCCGAGCTGTACGTCTACGGCCAGCGGGGATCGGGTC
TCGGCATGGCCAAGTATCTGCGCTGGATGGCCGTTGCCGTCGTCGAGGGCCTGGCTGTCTGGTACGGCGTCTGGG
CGGGATACGGTCGTGCCTCTCCCTCGGATGAAGGGCTGTACGCGCTGGGGACGCTGGTATTCACCGTGGGCGTCC
TGTGGATCAACTGGAAGCTATTGTGAGTTCCCCCTTTTTTTTTTTCCACCACGATGACGTATCGAAACAAGACGT
TACTGACGCCGCTACAAGCATCCTCGAAACACACTACAAACCGTGCGTCATCCTCGCCAGCTTCTTCCTCACGAC
CATGGGCTGGTTCGCCTGGCTCGCCTTCCTGGACGGCGTCTACGCCCCCAATCCCTCGGGCCCCTACCTCATCCA
CCACACCCTCCGCCAATCCTGGGGCATGGATATAACCTGGTGGTCCACCCTCTTCCTCACCCTCGCCCTCGTCTC
CCTCATCGAACTAGCCGTCGGCATCGTGACGAGACACGGACACCACCTCGTACCGCACATGTTGTCCCCCAACAA
CCGCCATGCCGCCACCACCTCGCCCTATTCTCTGGCCGAGAATGTCGAGGAGTGGGACGTTGCCTTGTGGCAGGA
ACTCGAACAGGATCCCGTGATTCGCGCCAGGCTTTACCGTCTTGCTCGTGATGGGGATTGTGATGATGAGGCTGC
TTTGCTATCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail