Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07167
Gene name
Locationscaffold_09:812543..813867
Strand+
Gene length (bp)1324
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.8E-22 112 363
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 9.2E-07 112 357
PF12146 Hydrolase_4 Serine aminopeptidase, S33 6.8E-07 113 206

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 42.33 22.74 61.92
Alive In ants, during behavior modification 79.59 44.83 114.36
Dead In ants, recently dead 71.75 40.68 102.82

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000454 yes
Alive Dead 0.583475 no
Dead Fungus 0.004680 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07167
MSHLQRAWARSKLGLANGSLEEDDEEGSMASEEHAADDDSSSASSVSSTGTIIPAPSQRLFARPEGVARGRALDP
IPWTTYFERELFLSPPGEPAVTFHAYLSSPVDKGVLFVMHHGAGSSGLTFAVVGAEIRKSLPSAGILAVDCRGHG
STVSPEGHALDLRLQTLSSDLFSVIQMTKDQMGWRQLPNIILVGHSLGGAVVTDLAMTGDLGSSLLGYVVLDVVE
GSAMDALQSMHTYLSSRPTGFASLQAAIDWHIRSRTVRNSISARTSVGPLLRLDEGADPSRPWIWRTNLSATQPF
WEGWFVGLSSKFLRAKGGKLLLLAGTDRLDTELTIGQMQGKYALQVFPEAGHFIQEDIPTQTATSLVDFYRRNDR
SALVLPPKVSDLLKQGKAV*
Coding >Ophcf2|07167
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGGCTCGCGAATGGCTCCCTTGAAGAGGATGACGAA
GAAGGCAGCATGGCTTCGGAAGAGCACGCTGCTGATGACGACTCCTCTTCGGCCTCGTCGGTTTCGTCTACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGCGTCGCTCGCGGCCGAGCTCTGGATCCC
ATTCCCTGGACGACCTACTTTGAGCGCGAACTGTTCCTCTCTCCGCCCGGCGAGCCGGCCGTCACCTTTCACGCC
TACCTCAGCTCGCCCGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGCTCCTCCGGCCTCACCTTC
GCCGTCGTCGGCGCCGAGATCCGCAAAAGCCTGCCCTCAGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGT
TCCACCGTCTCGCCAGAGGGCCACGCTCTCGATCTCAGGCTTCAGACGCTTTCGTCCGATCTCTTTTCCGTCATC
CAGATGACAAAAGACCAGATGGGATGGAGACAACTGCCCAACATAATCCTCGTCGGACACTCGCTGGGCGGCGCC
GTCGTCACCGACCTGGCCATGACCGGCGACCTGGGCAGCTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAA
GGTTCCGCCATGGACGCACTGCAGAGCATGCATACCTATCTCTCGTCCAGGCCGACAGGATTCGCCTCGCTGCAG
GCCGCCATCGACTGGCACATCCGCTCGAGGACTGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCGCTC
CTCAGGCTGGACGAAGGCGCTGATCCCTCCCGGCCCTGGATTTGGAGGACGAACCTGTCGGCCACGCAGCCTTTC
TGGGAGGGCTGGTTTGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTTCTAGCTGGC
ACCGATCGGCTCGATACCGAGCTGACAATTGGTCAGATGCAGGGCAAATATGCGCTGCAAGTATTTCCGGAAGCC
GGTCATTTCATCCAGGAGGACATCCCCACCCAGACAGCCACATCGCTCGTCGACTTTTACCGAAGAAACGACCGC
AGCGCACTGGTGTTGCCGCCCAAGGTATCAGACCTTTTGAAGCAGGGAAAAGCCGTGTGA
Transcript >Ophcf2|07167
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGGCTCGCGAATGGCTCCCTTGAAGAGGATGACGAA
GAAGGCAGCATGGCTTCGGAAGAGCACGCTGCTGATGACGACTCCTCTTCGGCCTCGTCGGTTTCGTCTACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGCGTCGCTCGCGGCCGAGCTCTGGATCCC
ATTCCCTGGACGACCTACTTTGAGCGCGAACTGTTCCTCTCTCCGCCCGGCGAGCCGGCCGTCACCTTTCACGCC
TACCTCAGCTCGCCCGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGCTCCTCCGGCCTCACCTTC
GCCGTCGTCGGCGCCGAGATCCGCAAAAGCCTGCCCTCAGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGT
TCCACCGTCTCGCCAGAGGGCCACGCTCTCGATCTCAGGCTTCAGACGCTTTCGTCCGATCTCTTTTCCGTCATC
CAGATGACAAAAGACCAGATGGGATGGAGACAACTGCCCAACATAATCCTCGTCGGACACTCGCTGGGCGGCGCC
GTCGTCACCGACCTGGCCATGACCGGCGACCTGGGCAGCTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAA
GGTTCCGCCATGGACGCACTGCAGAGCATGCATACCTATCTCTCGTCCAGGCCGACAGGATTCGCCTCGCTGCAG
GCCGCCATCGACTGGCACATCCGCTCGAGGACTGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCGCTC
CTCAGGCTGGACGAAGGCGCTGATCCCTCCCGGCCCTGGATTTGGAGGACGAACCTGTCGGCCACGCAGCCTTTC
TGGGAGGGCTGGTTTGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTTCTAGCTGGC
ACCGATCGGCTCGATACCGAGCTGACAATTGGTCAGATGCAGGGCAAATATGCGCTGCAAGTATTTCCGGAAGCC
GGTCATTTCATCCAGGAGGACATCCCCACCCAGACAGCCACATCGCTCGTCGACTTTTACCGAAGAAACGACCGC
AGCGCACTGGTGTTGCCGCCCAAGGTATCAGACCTTTTGAAGCAGGGAAAAGCCGTGTGA
Gene >Ophcf2|07167
ATGAGCCATTTGCAGCGGGCTTGGGCTCGTTCCAAGCTCGGGCTCGCGAATGGCTCCCTTGAAGAGGATGACGAA
GAAGGCAGCATGGCTTCGGAAGAGCACGCTGCTGATGACGACTCCTCTTCGGCCTCGTCGGTTTCGTCTACGGGC
ACCATCATTCCAGCGCCCAGCCAGCGGCTCTTCGCCCGTCCCGAGGGGTAAATCTCGACGTCGTCGGCCTGGCGA
CAGAAGTCCGATGCTGACTTCCATCTCGCGCCCAGCGTCGCTCGCGGCCGAGCTCTGGATCCCATTCCCTGGACG
ACCTACTTTGAGCGCGAACTGTTCCTCTCTCCGCCCGGCGAGCCGGCCGTCACCTTTCACGCCTACCTCAGCTCG
CCCGTCGACAAGGGCGTGCTTTTCGTCATGCATCACGGCGCCGGCTCCTCCGGCCTCACCTTCGCCGTCGTCGGC
GCCGAGATCCGCAAAAGCCTGCCCTCAGCCGGTATCCTTGCCGTCGACTGCAGGGGTCACGGTTCCACCGTCTCG
CCAGAGGGCCACGCTCTCGATCTCAGGCTTCAGACGCTTTCGTCCGATCTCTTTTCCGTCATCCAGATGACAAAA
GACCAGATGGGATGGAGACAACTGCCCAACATAATCCTCGTCGGACACTCGCTGGGCGGCGCCGTCGTCACCGAC
CTGGCCATGACCGGCGACCTGGGCAGCTCCCTGCTGGGCTATGTCGTCCTCGACGTCGTCGAAGGTTCCGCCATG
GACGCACTGCAGAGCATGCATACCTATCTCTCGTCCAGGCCGACAGGATTCGCCTCGCTGCAGGCCGCCATCGAC
TGGCACATCCGCTCGAGGACTGTGCGCAACTCCATCTCGGCCAGGACCTCGGTCGGCCCGCTCCTCAGGCTGGAC
GAAGGCGCTGATCCCTCCCGGCCCTGGATTTGGAGGACGAACCTGTCGGCCACGCAGCCTTTCTGGGAGGGCTGG
TTTGTCGGTCTCAGCAGCAAGTTCTTGCGGGCCAAGGGCGGCAAGCTGCTCCTTCTAGCTGGCACCGATCGGCTC
GATACCGAGCTGACAATTGGTCAGATGCAGGGTAGGTTGCGTCGCACGACGCCGGAGTCCGCGCGACCAGGGATC
ATGAATGACGGGCTGCTGACGACGTTTTAAAGGCAAATATGCGCTGCAAGTATTTCCGGAAGCCGGTCATTTCAT
CCAGGAGGACATCCCCACCCAGACAGCCACATCGCTCGTCGACTTTTACCGAAGAAACGACCGCAGCGCACTGGT
GTTGCCGCCCAAGGTATCAGACCTTTTGAAGCAGGGAAAAGCCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail