Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07166
Gene name
Locationscaffold_09:810477..812007
Strand-
Gene length (bp)1530
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 7.3E-08 165 363

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 305 327 22
2 342 364 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.86 0.21 3.50
Alive In ants, during behavior modification 15.40 6.21 24.58
Dead In ants, recently dead 27.36 13.23 41.48

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.006475 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07166
MAFGSGISCPVARLLKYENGFWTAGQVDLQRSQALPDVCYIFLEDRDWYKHQCTEQGRGRILAPFNIPSFLTSQL
CTESNGYFGCQSSFDANEGLIDLSMWFRCLVKRVLNHDEKKAPDGKDYWWDEMGFFTSWHHPNSSKILCVGTPES
FHDRLRVELDTAPSFLLKDPFAMLIPIIGQIIELYTDSTWRVRDKVREIEKTRGRQRADFVTMHNISRHAIHLNE
VCTVTIETLEKLLEQQKLTHGAIAWLDKTYKQQSQESLSFYLQMMKSLKLRSSSNQERINAEITLAYHIIASQDS
AVTKTIAVLTMTFLPASFVASLFSTTFFSSADDKKLAVSTKFWTYWVVAVPSTLLVLFAWWLFLQKSSSRNRWS*
Coding >Ophcf2|07166
ATGGCGTTCGGCAGCGGAATCAGCTGCCCGGTGGCAAGGCTCCTGAAATACGAGAACGGGTTCTGGACGGCCGGG
CAAGTCGATCTTCAGCGGAGCCAGGCTCTGCCTGACGTGTGCTACATCTTTCTAGAGGACCGGGATTGGTACAAA
CACCAATGCACGGAGCAGGGCCGCGGAAGGATCCTCGCGCCCTTCAACATACCCTCGTTTCTTACTAGCCAGCTT
TGCACTGAGAGCAATGGCTATTTTGGCTGCCAAAGCTCGTTTGATGCTAACGAAGGGTTGATAGATCTAAGCATG
TGGTTCCGATGCTTGGTCAAGAGGGTTTTGAATCACGATGAAAAAAAAGCTCCGGACGGTAAAGACTATTGGTGG
GATGAGATGGGCTTCTTTACAAGCTGGCATCATCCTAACAGCAGCAAGATACTATGCGTCGGCACGCCTGAGAGT
TTCCATGACCGATTACGGGTCGAGCTCGACACGGCTCCTTCATTCTTGTTAAAGGACCCTTTCGCAATGCTCATC
CCGATCATTGGTCAGATAATTGAGCTCTATACCGACAGCACCTGGAGAGTGCGGGATAAAGTGCGGGAAATCGAA
AAGACGAGAGGCAGGCAAAGAGCCGACTTCGTGACGATGCACAACATCTCCAGGCACGCCATTCACCTTAATGAG
GTTTGCACAGTAACCATAGAAACCTTGGAGAAGTTGCTTGAGCAGCAGAAGTTGACGCACGGGGCCATCGCCTGG
CTCGACAAGACGTACAAGCAGCAGTCACAGGAGTCCCTGAGCTTCTACCTGCAGATGATGAAAAGCCTGAAGCTA
CGCTCGTCATCGAACCAAGAAAGAATCAACGCCGAGATCACACTGGCATACCACATCATCGCCAGCCAGGACAGC
GCAGTCACCAAGACCATCGCCGTTCTCACCATGACGTTCCTACCGGCCTCATTCGTCGCGTCACTATTCAGCACC
ACCTTCTTCTCCTCGGCTGACGACAAGAAGCTAGCCGTTTCGACCAAGTTCTGGACGTACTGGGTGGTTGCAGTG
CCATCGACCCTACTCGTTCTCTTTGCTTGGTGGCTGTTTCTGCAAAAATCATCTTCTCGAAACCGATGGAGCTAG
Transcript >Ophcf2|07166
ATGGCGTTCGGCAGCGGAATCAGCTGCCCGGTGGCAAGGCTCCTGAAATACGAGAACGGGTTCTGGACGGCCGGG
CAAGTCGATCTTCAGCGGAGCCAGGCTCTGCCTGACGTGTGCTACATCTTTCTAGAGGACCGGGATTGGTACAAA
CACCAATGCACGGAGCAGGGCCGCGGAAGGATCCTCGCGCCCTTCAACATACCCTCGTTTCTTACTAGCCAGCTT
TGCACTGAGAGCAATGGCTATTTTGGCTGCCAAAGCTCGTTTGATGCTAACGAAGGGTTGATAGATCTAAGCATG
TGGTTCCGATGCTTGGTCAAGAGGGTTTTGAATCACGATGAAAAAAAAGCTCCGGACGGTAAAGACTATTGGTGG
GATGAGATGGGCTTCTTTACAAGCTGGCATCATCCTAACAGCAGCAAGATACTATGCGTCGGCACGCCTGAGAGT
TTCCATGACCGATTACGGGTCGAGCTCGACACGGCTCCTTCATTCTTGTTAAAGGACCCTTTCGCAATGCTCATC
CCGATCATTGGTCAGATAATTGAGCTCTATACCGACAGCACCTGGAGAGTGCGGGATAAAGTGCGGGAAATCGAA
AAGACGAGAGGCAGGCAAAGAGCCGACTTCGTGACGATGCACAACATCTCCAGGCACGCCATTCACCTTAATGAG
GTTTGCACAGTAACCATAGAAACCTTGGAGAAGTTGCTTGAGCAGCAGAAGTTGACGCACGGGGCCATCGCCTGG
CTCGACAAGACGTACAAGCAGCAGTCACAGGAGTCCCTGAGCTTCTACCTGCAGATGATGAAAAGCCTGAAGCTA
CGCTCGTCATCGAACCAAGAAAGAATCAACGCCGAGATCACACTGGCATACCACATCATCGCCAGCCAGGACAGC
GCAGTCACCAAGACCATCGCCGTTCTCACCATGACGTTCCTACCGGCCTCATTCGTCGCGTCACTATTCAGCACC
ACCTTCTTCTCCTCGGCTGACGACAAGAAGCTAGCCGTTTCGACCAAGTTCTGGACGTACTGGGTGGTTGCAGTG
CCATCGACCCTACTCGTTCTCTTTGCTTGGTGGCTGTTTCTGCAAAAATCATCTTCTCGAAACCGATGGAGCTAG
Gene >Ophcf2|07166
ATGGCGTTCGGCAGCGGAATCAGCTGCCCGGTGGCAAGGCTCCTGAAATACGGTAGACCCATATCGGTTCCTGCC
TTGGTTCTAAGCCCCTTACTGACCACTTCTCGCAGAGAACGGGTTCTGGACGGCCGGGCAAGTCGATCTTCAGGT
CAGTTCGAGTGGTTCATCGCTGCCCTGATCCTGTTTGTTGACACTGACACACGTCGCAGCGGAGCCAGGCTCTGC
CTGACGTGTGCTACATGTCAGGGAAACCTTTATTCTCTACAGGACATCTCATTCTGATGCTATTCCGCAGCTTTC
TAGAGGACCGGGATTGGTACAAACACCAATGCACGGAGCAGGGCCGCGGAAGGATCCTCGCGCCCTTCAACATAC
CCTCGTTTCTTACTAGCCAGCTTTGCACTGAGAGCAATGGCTATTTTGGCTGCCAAAGCTCGTTTGATGCTAACG
AAGGGTTGATAGATCTAAGTATACCTTGCTCTTGTCCAGCGGCTGTGAGCAGCTTTTATTGACACATGTCTTTGA
CAGGCATGTGGTTCCGATGCTTGGTCAAGAGGGTTTTGAATCACGATGAAAAAAAAGCTCCGGACGGTAAAGACT
ATTGGTGGGATGAGATGGGCTTCTTTACAAGCTGGCATCATCCTAACAGCAGCAAGATACTATGCGTCGGCACGC
CTGAGAGTTTCCATGACCGATTACGGGTCGAGCTCGACACGGCTCCTTCATTCTTGTTAAAGGACCCTTTCGCAA
TGCTCATCCCGATCATTGGTCAGATAATTGAGCTCTATACCGACAGCACCTGGAGAGTGCGGGATAAAGTGCGGG
AAATCGAAAAGGTCTTTAGCTTCCAGTATGGTGCCGAGATGCTTGCGAGCTGACTTTGGTGTCAAAGACGAGAGG
CAGGCAAAGAGCCGACTTCGTGACGATGCACAACATCTCCAGGCACGCCATTCACCTTAATGAGGTTTGCACAGT
AACCATAGAAACCTTGGAGAAGTTGCTTGAGCAGCAGAAGTTGACGCACGGGGCCATCGCCTGGCTCGACAAGAC
GTACAAGCAGCAGTCACAGGAGTCCCTGAGCTTCTACCTGCAGATGATGAAAAGCCTGAAGCTACGCTCGTCATC
GAACCAAGAAAGAATCAACGCCGAGATCACACTGGTAACGTGACGACAAGAAGCGAGGCAGGTCCTGGTGACGCG
GCTAATCAGCGTCGCAGGCATACCACATCATCGCCAGCCAGGACAGCGCAGTCACCAAGACCATCGCCGTTCTCA
CCATGACGTTCCTACCGGCCTCATTCGTCGCGGTAAGACGGCACGGGCCGTGTCCTCTCTTTCATGGCATGTGGT
TGACGTCAAGACCAGTCACTATTCAGCACCACCTTCTTCTCCTCGGCTGACGACAAGAAGCTAGCCGTTTCGACC
AAGTTCTGGACGTACTGGGTGGTTGCAGTGCCATCGACCCTACTCGTTCTCTTTGCTTGGTGGCTGTTTCTGCAA
AAATCATCTTCTCGAAACCGATGGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail