Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07162
Gene name
Locationscaffold_09:791648..793568
Strand-
Gene length (bp)1920
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 1.3E-133 170 613
PF14558 TRP_N ML-like domain 5.7E-35 27 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 341 363 22
2 387 409 22
3 424 446 22
4 483 502 19
5 512 529 17
6 536 558 22
7 573 595 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07162
MARLDASLWRLLLWTLVFSSTRADDILKTDGFSSCGGDSIKVDKVDISYDRDNKALIFDVAGSSLREQNVTAFLE
VTAYGNSVYKNSFNPCDAGTFVQRLCPVPKDSFSAQGSQRIPDQFASMVPEIAFRVPDIAAQATLELKSLDGDEV
ACIRSSVTNGKTANTGAARVVAVGVVGVALAVSGVSSASSLVSGAAAGGAGAVVAPSPSFSEAFGWFQGMAVSGM
FSVNYPPVYRSFSSNFAFSAFLVPWVGLESSIDDFRRGAGGNLTEDNVDFIRNATMVYPDGSSTSPNRAMAKFKR
AVDDFAALVARDEGNQTSNLQHAVQGIQAYAARLSVPKSDIFMTALLVVAIVVAVIVVGILLVKVVLEAWALFGS
FPRSLAGFRKHYWGSIARTITSLILILYGIWVLYCIFQFTHGDTVAAKALAAVTLVIFTAVLAFFTWKIWSVARR
LKREGGDADGLYNDKQIWVKYSLFYEAYKKSYWWLFVPTIIYMFIKGATLAATDGNGRTQTVAQLVIEALMLVLL
LWSRPYERRSGNAVNIAIAVVRVLSVACILVFVEEFGIRQTTQTVAGVVLIVVQSTLTGVLAILIAWNAFNACCK
VNPHRKRRKDMGKTSNLPPLRRRRRRRRRRRRHHLHPTR*
Coding >Ophcf2|07162
ATGGCTCGTCTGGATGCCTCGCTTTGGAGGCTGCTGCTATGGACCCTCGTCTTCTCCTCGACTCGCGCCGATGAT
ATCCTCAAGACGGATGGCTTCAGTTCGTGTGGTGGTGATTCGATAAAGGTCGACAAGGTGGACATCTCGTACGAT
CGGGACAACAAGGCTCTGATCTTTGACGTGGCCGGGTCCAGCCTCCGCGAGCAAAACGTCACGGCCTTTCTCGAA
GTCACGGCCTATGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCCGGCACATTTGTCCAGCGTCTG
TGTCCCGTGCCCAAGGACTCCTTCAGCGCTCAGGGCTCGCAGAGGATACCGGATCAGTTCGCGTCCATGGTTCCG
GAAATCGCCTTTCGGGTGCCCGACATTGCCGCCCAGGCGACGCTGGAGCTCAAGAGCTTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGACCAACGGCAAGACGGCCAACACCGGAGCCGCCCGTGTCGTCGCCGTCGGAGTC
GTCGGCGTCGCCCTCGCCGTCTCCGGCGTCTCGTCCGCCTCGTCTCTCGTCTCGGGCGCTGCCGCCGGCGGTGCA
GGGGCCGTCGTCGCCCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGTGGCATG
TTCTCGGTCAACTACCCGCCCGTCTACCGCAGCTTCAGCTCCAACTTTGCCTTCTCTGCCTTTCTCGTTCCGTGG
GTCGGTCTCGAGTCGTCCATCGATGACTTTCGGAGGGGCGCCGGTGGGAACTTGACGGAGGATAACGTCGATTTC
ATCCGCAATGCCACCATGGTCTACCCGGACGGATCCAGCACCAGCCCCAATCGGGCCATGGCCAAGTTCAAGCGA
GCCGTCGATGATTTCGCCGCTCTCGTCGCCCGCGACGAGGGGAACCAGACGTCCAATCTCCAGCACGCCGTCCAG
GGCATCCAAGCCTACGCAGCGAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTGGCC
ATCGTCGTCGCCGTCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTTCTCGAAGCCTGGGCCCTCTTCGGCAGC
TTCCCCAGATCCCTCGCCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATCCTC
ATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGACACCGTCGCCGCAAAGGCCCTC
GCCGCCGTCACCCTCGTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGTCGT
CTGAAACGCGAGGGCGGCGACGCGGATGGCCTCTACAACGATAAGCAGATCTGGGTCAAGTACTCCCTCTTCTAT
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGACCATCATCTACATGTTCATCAAGGGCGCCACCCTC
GCGGCCACCGACGGCAACGGCAGGACCCAGACGGTCGCCCAGCTCGTCATCGAAGCCCTCATGCTCGTCCTCCTG
CTCTGGAGCCGACCCTACGAGCGCCGCTCGGGCAACGCCGTCAACATCGCCATCGCCGTCGTCCGCGTCCTGTCC
GTGGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACGCAGACCGTCGCCGGCGTCGTCCTC
ATCGTCGTCCAGTCTACGCTGACGGGCGTCTTGGCCATCCTCATCGCTTGGAATGCCTTTAACGCCTGCTGCAAG
GTCAACCCGCACCGCAAGCGAAGAAAGGACATGGGTAAGACTTCCAACCTCCCACCCCTTCGTCGTCGTCGTCGT
CGTCGTCGTCGTCGTCGTCGACACCACCTCCATCCCACCCGCTAA
Transcript >Ophcf2|07162
ATGGCTCGTCTGGATGCCTCGCTTTGGAGGCTGCTGCTATGGACCCTCGTCTTCTCCTCGACTCGCGCCGATGAT
ATCCTCAAGACGGATGGCTTCAGTTCGTGTGGTGGTGATTCGATAAAGGTCGACAAGGTGGACATCTCGTACGAT
CGGGACAACAAGGCTCTGATCTTTGACGTGGCCGGGTCCAGCCTCCGCGAGCAAAACGTCACGGCCTTTCTCGAA
GTCACGGCCTATGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCCGGCACATTTGTCCAGCGTCTG
TGTCCCGTGCCCAAGGACTCCTTCAGCGCTCAGGGCTCGCAGAGGATACCGGATCAGTTCGCGTCCATGGTTCCG
GAAATCGCCTTTCGGGTGCCCGACATTGCCGCCCAGGCGACGCTGGAGCTCAAGAGCTTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGACCAACGGCAAGACGGCCAACACCGGAGCCGCCCGTGTCGTCGCCGTCGGAGTC
GTCGGCGTCGCCCTCGCCGTCTCCGGCGTCTCGTCCGCCTCGTCTCTCGTCTCGGGCGCTGCCGCCGGCGGTGCA
GGGGCCGTCGTCGCCCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGTGGCATG
TTCTCGGTCAACTACCCGCCCGTCTACCGCAGCTTCAGCTCCAACTTTGCCTTCTCTGCCTTTCTCGTTCCGTGG
GTCGGTCTCGAGTCGTCCATCGATGACTTTCGGAGGGGCGCCGGTGGGAACTTGACGGAGGATAACGTCGATTTC
ATCCGCAATGCCACCATGGTCTACCCGGACGGATCCAGCACCAGCCCCAATCGGGCCATGGCCAAGTTCAAGCGA
GCCGTCGATGATTTCGCCGCTCTCGTCGCCCGCGACGAGGGGAACCAGACGTCCAATCTCCAGCACGCCGTCCAG
GGCATCCAAGCCTACGCAGCGAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTGGCC
ATCGTCGTCGCCGTCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTTCTCGAAGCCTGGGCCCTCTTCGGCAGC
TTCCCCAGATCCCTCGCCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATCCTC
ATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGACACCGTCGCCGCAAAGGCCCTC
GCCGCCGTCACCCTCGTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGTCGT
CTGAAACGCGAGGGCGGCGACGCGGATGGCCTCTACAACGATAAGCAGATCTGGGTCAAGTACTCCCTCTTCTAT
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGACCATCATCTACATGTTCATCAAGGGCGCCACCCTC
GCGGCCACCGACGGCAACGGCAGGACCCAGACGGTCGCCCAGCTCGTCATCGAAGCCCTCATGCTCGTCCTCCTG
CTCTGGAGCCGACCCTACGAGCGCCGCTCGGGCAACGCCGTCAACATCGCCATCGCCGTCGTCCGCGTCCTGTCC
GTGGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACGCAGACCGTCGCCGGCGTCGTCCTC
ATCGTCGTCCAGTCTACGCTGACGGGCGTCTTGGCCATCCTCATCGCTTGGAATGCCTTTAACGCCTGCTGCAAG
GTCAACCCGCACCGCAAGCGAAGAAAGGACATGGGTAAGACTTCCAACCTCCCACCCCTTCGTCGTCGTCGTCGT
CGTCGTCGTCGTCGTCGTCGACACCACCTCCATCCCACCCGCTAA
Gene >Ophcf2|07162
ATGGCTCGTCTGGATGCCTCGCTTTGGAGGCTGCTGCTATGGACCCTCGTCTTCTCCTCGACTCGCGCCGATGAT
ATCCTCAAGACGGATGGCTTCAGTTCGTGTGGTGGTGATTCGATAAAGGTCGACAAGGTGGACATCTCGTACGAT
CGGGACAACAAGGCTCTGATCTTTGACGTGGCCGGGTCCAGCCTCCGCGAGCAAAACGTCACGGCCTTTCTCGAA
GTCACGGCCTATGGAAACTCGGTCTACAAGAACAGCTTCAACCCGTGTGATGCCGGCACATTTGTCCAGCGTCTG
TGTCCCGTGCCCAAGGACTCCTTCAGCGCTCAGGGCTCGCAGAGGATACCGGATCAGTTCGCGTCCATGGTTCCG
GAAATCGCCTTTCGGGTGCCCGACATTGCCGCCCAGGCGACGCTGGAGCTCAAGAGCTTGGATGGCGACGAGGTG
GCCTGCATCCGCTCCTCCGTGACCAACGGCAAGACGGCCAACACCGGAGCCGCCCGTGTCGTCGCCGTCGGAGTC
GTCGGCGTCGCCCTCGCCGTCTCCGGCGTCTCGTCCGCCTCGTCTCTCGTCTCGGGCGCTGCCGCCGGCGGTGCA
GGGGCCGTCGTCGCCCCGAGTCCCAGCTTCTCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCTGTCAGTGGCATG
TTCTCGGTCAACTACCCGCCCGTCTACCGCAGCTTCAGCTCCAACTTTGCCTTCTCTGCCTTTCTCGTTCCGTGG
GTCGGTCTCGAGTCGTCCATCGATGACTTTCGGAGGGGCGCCGGTGGGAACTTGACGGAGGATAACGTCGATTTC
ATCCGCAATGCCACCATGGTCTACCCGGACGGATCCAGCACCAGCCCCAATCGGGCCATGGCCAAGTTCAAGCGA
GCCGTCGATGATTTCGCCGCTCTCGTCGCCCGCGACGAGGGGAACCAGACGTCCAATCTCCAGCACGCCGTCCAG
GGCATCCAAGCCTACGCAGCGAGGCTCTCGGTCCCCAAGTCGGACATCTTCATGACGGCCCTTCTCGTCGTGGCC
ATCGTCGTCGCCGTCATCGTCGTCGGCATCCTCCTCGTCAAGGTCGTTCTCGAAGCCTGGGCCCTCTTCGGCAGC
TTCCCCAGATCCCTCGCCGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGGACCATCACCTCGCTCATCCTC
ATCCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACCCACGGCGACACCGTCGCCGCAAAGGCCCTC
GCCGCCGTCACCCTCGTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAGATCTGGAGCGTCGCCCGTCGT
CTGAAACGCGAGGGCGGCGACGCGGATGGCCTCTACAACGATAAGCAGATCTGGGTCAAGTACTCCCTCTTCTAT
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGACCATCATCTACATGTTCATCAAGGGCGCCACCCTC
GCGGCCACCGACGGCAACGGCAGGACCCAGACGGTCGCCCAGCTCGTCATCGAAGCCCTCATGCTCGTCCTCCTG
CTCTGGAGCCGACCCTACGAGCGCCGCTCGGGCAACGCCGTCAACATCGCCATCGCCGTCGTCCGCGTCCTGTCC
GTGGCCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACGCAGACCGTCGCCGGCGTCGTCCTC
ATCGTCGTCCAGTCTACGCTGACGGGCGTCTTGGCCATCCTCATCGCTTGGAATGCCTTTAACGCCTGCTGCAAG
GTCAACCCGCACCGCAAGCGAAGAAAGGACATGGGTAAGACTTCCAACCTCCCACCCCTTCGTCGTCGTCGTCGT
CGTCGTCGTCGTCGTCGTCGACACCACCTCCATCCCACCCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail