Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07155
Gene name
Locationscaffold_09:776331..777351
Strand-
Gene length (bp)1020
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 1.2E-41 124 284
PF13207 AAA_17 AAA domain 5.3E-31 125 262

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 85.26 47.93 122.58
Alive In ants, during behavior modification 105.60 59.68 151.51
Dead In ants, recently dead 103.40 59.04 147.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.292726 no
Alive Dead 0.919667 no
Dead Fungus 0.340493 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07155
MPHATLRQAVSIARASLRSRPGRLPSLPRRFLSSPPQNSRDDKPENHSSGNNHHHDNGNRPRQTANIKFLPFIAI
IAVGSAAYVALVNRRKAIAMPPAADSQQDLPPPSSTPTFSPEKATVVFVLGGPGAGKGTQCARLVDQYAFTHLSA
GDLLRAEQDRAGSQFGDLIRSHIKDGLIVPMEVTVQLLENAMTEAMARPGPRPARFLIDGFPRKLDQAYRFEGSV
CEPSLVLFYDCPENVLRDRLLERGKTSGRADDNAESILKRFRTFVETSMPVVDHYDKRGAVIKIDATRDKDAVFA
DTQKRLKEKLGDDF*
Coding >Ophcf2|07155
ATGCCCCACGCGACCTTGCGCCAAGCCGTTTCCATCGCCCGCGCCTCTCTCCGCTCTCGGCCTGGTCGTCTTCCG
TCCCTGCCGAGGCGATTCCTCAGCTCGCCTCCGCAAAACAGCCGCGACGACAAGCCGGAGAATCACAGTAGCGGA
AACAACCACCACCACGATAACGGCAACCGTCCCCGTCAAACCGCTAACATCAAGTTCCTCCCCTTTATAGCCATC
ATCGCCGTCGGTTCAGCCGCCTACGTCGCTCTCGTCAACCGCCGCAAAGCAATAGCAATGCCTCCAGCCGCAGAC
TCCCAGCAAGATCTCCCCCCCCCTTCCTCGACACCGACCTTCTCCCCCGAAAAGGCAACCGTCGTCTTCGTCCTG
GGCGGCCCCGGCGCTGGAAAAGGCACCCAATGCGCTCGCCTCGTCGACCAATACGCCTTCACCCACCTCTCAGCC
GGCGACCTCCTCCGCGCCGAGCAGGACCGTGCCGGCTCGCAGTTCGGCGACCTGATCCGCTCCCACATTAAAGAC
GGGCTCATCGTCCCCATGGAAGTCACCGTCCAGCTGCTGGAGAACGCCATGACGGAGGCCATGGCTCGTCCCGGT
CCGCGGCCCGCTCGCTTCCTCATTGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGGGCTCCGTC
TGCGAACCCAGTCTCGTCCTCTTTTACGATTGTCCCGAGAATGTCCTTCGCGATCGCCTTCTTGAGCGTGGAAAG
ACGAGCGGTAGGGCCGACGATAATGCCGAGAGCATCCTCAAGCGCTTCCGCACTTTTGTCGAGACGAGCATGCCC
GTCGTCGACCACTACGACAAGAGGGGCGCCGTCATCAAGATAGACGCCACCCGCGACAAGGACGCCGTCTTTGCC
GATACCCAGAAACGCCTCAAGGAGAAGCTCGGCGACGACTTTTGA
Transcript >Ophcf2|07155
ATGCCCCACGCGACCTTGCGCCAAGCCGTTTCCATCGCCCGCGCCTCTCTCCGCTCTCGGCCTGGTCGTCTTCCG
TCCCTGCCGAGGCGATTCCTCAGCTCGCCTCCGCAAAACAGCCGCGACGACAAGCCGGAGAATCACAGTAGCGGA
AACAACCACCACCACGATAACGGCAACCGTCCCCGTCAAACCGCTAACATCAAGTTCCTCCCCTTTATAGCCATC
ATCGCCGTCGGTTCAGCCGCCTACGTCGCTCTCGTCAACCGCCGCAAAGCAATAGCAATGCCTCCAGCCGCAGAC
TCCCAGCAAGATCTCCCCCCCCCTTCCTCGACACCGACCTTCTCCCCCGAAAAGGCAACCGTCGTCTTCGTCCTG
GGCGGCCCCGGCGCTGGAAAAGGCACCCAATGCGCTCGCCTCGTCGACCAATACGCCTTCACCCACCTCTCAGCC
GGCGACCTCCTCCGCGCCGAGCAGGACCGTGCCGGCTCGCAGTTCGGCGACCTGATCCGCTCCCACATTAAAGAC
GGGCTCATCGTCCCCATGGAAGTCACCGTCCAGCTGCTGGAGAACGCCATGACGGAGGCCATGGCTCGTCCCGGT
CCGCGGCCCGCTCGCTTCCTCATTGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGGGCTCCGTC
TGCGAACCCAGTCTCGTCCTCTTTTACGATTGTCCCGAGAATGTCCTTCGCGATCGCCTTCTTGAGCGTGGAAAG
ACGAGCGGTAGGGCCGACGATAATGCCGAGAGCATCCTCAAGCGCTTCCGCACTTTTGTCGAGACGAGCATGCCC
GTCGTCGACCACTACGACAAGAGGGGCGCCGTCATCAAGATAGACGCCACCCGCGACAAGGACGCCGTCTTTGCC
GATACCCAGAAACGCCTCAAGGAGAAGCTCGGCGACGACTTTTGA
Gene >Ophcf2|07155
ATGCCCCACGCGACCTTGCGCCAAGCCGTTTCCATCGCCCGCGCCTCTCTCCGCTCTCGGCCTGGTCGTCTTCCG
TCCCTGCCGAGGCGATTCCTCAGCTCGCCTCCGCAAAACAGCCGCGACGACAAGCCGGAGAATCACAGTAGCGGA
AACAACCACCACCACGATAACGGCAACCGTCCCCGTCAAACCGCTAACATCAAGTTCCTCCCCTTTATAGCCATC
ATCGCCGTCGGTTCAGCCGCCTACGTCGCTCTCGTCAACCGCCGCAAAGGTTTCAATTCATCCTACCACGCGTTT
TGTTTTTCTAGAATCCTTGGACAATACCGCTGACCCCTTCCCTTGGTAGCAATAGCAATGCCTCCAGCCGCAGAC
TCCCAGCAAGATCTCCCCCCCCCTTCCTCGACACCGACCTTCTCCCCCGAAAAGGCAACCGTCGTCTTCGTCCTG
GGCGGCCCCGGCGCTGGAAAAGGCACCCAATGCGCTCGCCTCGTCGACCAATACGCCTTCACCCACCTCTCAGCC
GGCGACCTCCTCCGCGCCGAGCAGGACCGTGCCGGCTCGCAGTTCGGCGACCTGATCCGCTCCCACATTAAAGAC
GGGCTCATCGTCCCCATGGAAGTCACCGTCCAGCTGCTGGAGAACGCCATGACGGAGGCCATGGCTCGTCCCGGT
CCGCGGCCCGCTCGCTTCCTCATTGACGGCTTCCCCCGCAAGCTCGATCAGGCCTATCGCTTCGAGGGCTCCGTC
TGCGAACCCAGTCTCGTCCTCTTTTACGATTGTCCCGAGAATGTCCTTCGCGATCGCCTTCTTGAGCGTGGAAAG
ACGAGCGGTAGGGCCGACGATAATGCCGAGAGCATCCTCAAGCGCTTCCGCACTTTTGTCGAGACGAGCATGCCC
GTCGTCGACCACTACGACAAGAGGGGCGCCGTCATCAAGATAGACGCCACCCGCGACAAGGACGCCGTCTTTGCC
GATACCCAGAAACGCCTCAAGGAGAAGCTCGGCGACGACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail