Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07151
Gene name
Locationscaffold_09:761076..765234
Strand-
Gene length (bp)4158
Transcript length (bp)4041
Coding sequence length (bp)4041
Protein length (aa) 1347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 1.2E-15 910 997
PF06292 MUN MUN domain 2.2E-10 712 847

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6254 0.3213 0.1215 0.2826 0.1418 0.0078 0.1592 0.3865 0.3858 0.0166

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3450
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4547
Ophiocordyceps australis map64 (Brazil) OphauB2|1706
Ophiocordyceps camponoti-floridani Ophcf2|07151 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3333
Ophiocordyceps kimflemingae Ophio5|2283
Ophiocordyceps subramaniannii Hirsu2|6574

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07151
MSTASRQSQVANLSNASRNSRPPSRRPRHVPSRTRSSVHHLAVEHDVARSFALRTAYLHHLLQPRPKRKQYVTAP
KQRSYTSVTQLLHEYVSGSSSSLKLPHAFATQLLDRVGGVVRGSETLPGFNDAAVKRSFAEAYTAFSEKAFRKSI
DKERKFEPLVLIFYSAATKSAQKGRLPDDDSWKILPDRHLALFLRLAADILRNHGHDRDRPDLMSRLLTLESKIL
TNDQNLFETGPDGAGTAVEVAVPLTYGVKDMPMVQIVAAIFGLSQSEVQAEIDDKRTVWTEEAALRDLKSYQLRL
NSDKPGALRSQDFDSVDAFNDWKKSEAPHLSQMMLDILTVKPELTKRSTARAEKTSASRPQSLYLDDPVCVSPTR
PVSMFGDGLAGFDSLSIDSDASINEPVYTFTPPNPLAFYKYIIQHAMAFDQLHADPELDYQPLSKQSMELATELC
VRWRIPQSARLIALLAVATRKFVDREIVPTELDAIFDLVKSPLPEAKKPPHITQYAAALTDIDPSRWTVDDFTIY
QGTLHTLHDTLLRELYDLLGQCYDAKPPDIAAIMFLLENHIGSDPVFSPSPAAYVEFSDQLAQGLARRAADVYRE
YMEKEIPAHKEEWEFGHVVKLGKSVTKLCDRIRKRYRNTPEIMGVNPLEILVAEVLPSFEGDAGAIVEAILSGAA
ETGDEVEIQEGFDLYKELVEIRRVHQQSLPEIPLAVNVEDLLSSFVWRWIRNAEERIPEFVDQAIKQDQFQVRSE
GPDQAARDSERHSVSVIDLFMLFNQTVGQIFALEWGNEVHHAKFMTAIARIITTGIGLYCDAVEQRFAKEMDRLS
ADELAVQTKTAQERWVQMAKDAWSNKEKVEPFQFYAESFVKLNNIEYAMQELDKLEKSMNSEACALVLRQMESPR
AKARKPSKYTFTIKVVEAEDVKACDPNGYSDPYVVFGDEYQKRLHKTRVIHRSLNPRWDESFEITVQGPINVIAT
IWDHDTFGDHDYVGRTALKLDPAHFGDYLPRELWLDLDLQGRLLMRVSMEGERDDIEFHFGKAFRHLKRTERDMV
RKVTDKLITHITATLSPETIRGVLGHGGVLGASVTSLWKKRAAKAPTTTVSQVEGALAPLFTYFDENFAIMKQTL
TEATMTAVMTRLWKEVLMAIENLLVPPLSEKPSTKKPLTRRELDVVYHWLEMLFTFFNARDEDSGEQLGVPGEVL
KSPKWHELASLNFFYLEDTNSLIGESERMATAAALRAQQALQQNRMSAPAGLGSGIGSLAGMGTIKRGKSVMMSR
NLGTMRKAKEARRREAQAEPSDDMILRILRMRPDAAQYLKERHRQKERQAAAAAAALIVKNSVMQSWNRGG*
Coding >Ophcf2|07151
ATGTCGACAGCCTCGCGTCAATCTCAGGTAGCCAACCTCTCGAACGCCTCGCGCAACTCTCGACCGCCCAGTCGT
CGCCCTCGCCACGTCCCGTCCAGGACACGATCCTCCGTCCACCATCTGGCCGTCGAGCACGATGTCGCTCGCAGC
TTTGCCCTACGCACCGCCTATCTCCATCATCTTCTGCAGCCCCGGCCTAAGCGCAAGCAATACGTGACCGCGCCA
AAGCAACGATCCTATACCTCAGTAACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAACTGCTCGACCGCGTCGGAGGCGTCGTCCGCGGCAGCGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCACTTGTTCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGCCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTCCGCAACCATGGTCACGACCGCGACCGGCCGGACCTCATGTCAAGGCTGCTCACGCTCGAGAGCAAGATCCTC
ACCAACGACCAGAACCTGTTCGAGACGGGCCCCGACGGCGCCGGCACGGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGTCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAACGCACCGTCTGGACAGAAGAGGCAGCCCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGTGCGCTGAGAAGCCAAGACTTTGACAGCGTCGATGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGACATCCTGACTGTCAAGCCAGAATTGACCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCAAGCCGGCCGCAGTCGCTATACCTCGACGACCCGGTCTGTGTGAGTCCCACCCGG
CCCGTGTCCATGTTCGGAGACGGCCTGGCCGGTTTCGACTCCCTGTCCATCGACTCGGATGCGAGCATAAACGAG
CCAGTCTACACCTTTACCCCTCCCAATCCTCTCGCCTTCTACAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGCTGGCGACGGAGCTCTGC
GTGCGATGGCGCATTCCCCAATCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCGACCCGTAAGTTTGTGGACCGC
GAGATTGTGCCTACCGAGCTGGACGCCATCTTCGACCTGGTCAAGTCGCCTCTGCCAGAGGCCAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACGGACATCGACCCGAGCAGGTGGACAGTCGACGACTTCACCATCTAC
CAGGGGACCTTGCATACCCTTCACGACACACTCCTCCGTGAGCTCTACGACCTACTCGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCCGCCATCATGTTCCTCCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCCCCGAGC
CCCGCCGCGTATGTCGAATTCTCCGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAATTCGGCCATGTCGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAACACACCTGAAATCATGGGGGTCAACCCGCTGGAGATT
CTGGTGGCAGAGGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAAGCCATCCTCAGCGGCGCCGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTTGATCTCTACAAGGAGCTGGTCGAGATTCGCCGAGTCCAC
CAACAATCTCTCCCAGAGATCCCGTTGGCGGTCAACGTCGAGGATCTGCTCTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGCATACCGGAGTTCGTCGACCAGGCCATCAAGCAGGATCAGTTTCAGGTTCGCTCAGAG
GGTCCGGATCAGGCAGCCAGAGACTCGGAACGGCACAGCGTTTCCGTAATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGCCAGATCTTCGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTTTACTGCGACGCCGTGGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGGTGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTCTATGCCGAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAG
GAGCTGGACAAGCTGGAGAAGAGCATGAACTCGGAGGCGTGCGCGCTGGTGCTCCGGCAGATGGAGAGCCCCAGG
GCCAAGGCACGGAAGCCCAGCAAATACACCTTTACCATCAAAGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGAC
CCCAACGGCTACAGCGATCCATACGTCGTCTTCGGCGACGAGTATCAGAAGCGTCTCCACAAGACGCGCGTCATC
CATCGAAGCCTCAACCCCCGTTGGGACGAGTCGTTCGAGATTACGGTGCAGGGTCCGATCAACGTCATCGCGACG
ATATGGGACCACGACACGTTCGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTT
GGCGACTACCTGCCCCGCGAGCTGTGGCTGGATCTGGATCTGCAGGGTCGCCTGCTGATGAGGGTCAGCATGGAA
GGGGAGCGAGACGACATCGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGGACGGAGAGGGACATGGTC
CGCAAGGTCACGGACAAGCTCATCACGCATATCACGGCGACGCTGTCCCCGGAAACGATCCGGGGCGTTCTCGGT
CACGGTGGCGTTCTCGGCGCCTCAGTGACGAGCCTGTGGAAGAAGCGAGCGGCCAAGGCGCCGACCACGACGGTC
AGCCAGGTGGAAGGGGCGCTGGCGCCCTTGTTCACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTG
ACCGAGGCGACGATGACGGCCGTCATGACGCGGCTGTGGAAGGAGGTGTTGATGGCGATTGAGAACCTCCTAGTC
CCTCCTTTGTCGGAGAAGCCGTCGACGAAGAAGCCGCTGACGCGTCGGGAGCTGGACGTGGTATATCACTGGCTG
GAGATGCTCTTCACCTTTTTCAACGCCAGAGACGAGGACTCTGGTGAGCAGCTCGGGGTTCCGGGCGAGGTGCTC
AAGTCGCCTAAGTGGCACGAGCTGGCCTCGCTCAATTTCTTCTACCTCGAGGACACGAACAGCCTGATTGGCGAG
TCGGAGCGAATGGCAACGGCAGCGGCCCTGAGGGCGCAGCAAGCGTTGCAGCAGAACCGCATGTCGGCTCCGGCG
GGCCTCGGGTCCGGGATCGGCTCGCTGGCCGGCATGGGGACCATCAAGCGCGGCAAGAGCGTCATGATGAGCCGA
AACCTGGGCACGATGCGCAAGGCCAAGGAGGCCAGACGGCGGGAAGCTCAGGCGGAGCCGAGCGACGACATGATC
CTGCGTATCCTGCGCATGAGGCCCGATGCGGCGCAGTACCTCAAGGAGAGGCACCGGCAGAAGGAGCGGCAGGCT
GCGGCGGCGGCGGCGGCGCTGATTGTCAAGAACAGCGTGATGCAGAGTTGGAACAGAGGGGGGTGA
Transcript >Ophcf2|07151
ATGTCGACAGCCTCGCGTCAATCTCAGGTAGCCAACCTCTCGAACGCCTCGCGCAACTCTCGACCGCCCAGTCGT
CGCCCTCGCCACGTCCCGTCCAGGACACGATCCTCCGTCCACCATCTGGCCGTCGAGCACGATGTCGCTCGCAGC
TTTGCCCTACGCACCGCCTATCTCCATCATCTTCTGCAGCCCCGGCCTAAGCGCAAGCAATACGTGACCGCGCCA
AAGCAACGATCCTATACCTCAGTAACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAACTGCTCGACCGCGTCGGAGGCGTCGTCCGCGGCAGCGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCACTTGTTCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGCCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTCCGCAACCATGGTCACGACCGCGACCGGCCGGACCTCATGTCAAGGCTGCTCACGCTCGAGAGCAAGATCCTC
ACCAACGACCAGAACCTGTTCGAGACGGGCCCCGACGGCGCCGGCACGGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGTCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAACGCACCGTCTGGACAGAAGAGGCAGCCCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGTGCGCTGAGAAGCCAAGACTTTGACAGCGTCGATGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGACATCCTGACTGTCAAGCCAGAATTGACCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCAAGCCGGCCGCAGTCGCTATACCTCGACGACCCGGTCTGTGTGAGTCCCACCCGG
CCCGTGTCCATGTTCGGAGACGGCCTGGCCGGTTTCGACTCCCTGTCCATCGACTCGGATGCGAGCATAAACGAG
CCAGTCTACACCTTTACCCCTCCCAATCCTCTCGCCTTCTACAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGCTGGCGACGGAGCTCTGC
GTGCGATGGCGCATTCCCCAATCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCGACCCGTAAGTTTGTGGACCGC
GAGATTGTGCCTACCGAGCTGGACGCCATCTTCGACCTGGTCAAGTCGCCTCTGCCAGAGGCCAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACGGACATCGACCCGAGCAGGTGGACAGTCGACGACTTCACCATCTAC
CAGGGGACCTTGCATACCCTTCACGACACACTCCTCCGTGAGCTCTACGACCTACTCGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCCGCCATCATGTTCCTCCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCCCCGAGC
CCCGCCGCGTATGTCGAATTCTCCGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAATTCGGCCATGTCGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAACACACCTGAAATCATGGGGGTCAACCCGCTGGAGATT
CTGGTGGCAGAGGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAAGCCATCCTCAGCGGCGCCGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTTGATCTCTACAAGGAGCTGGTCGAGATTCGCCGAGTCCAC
CAACAATCTCTCCCAGAGATCCCGTTGGCGGTCAACGTCGAGGATCTGCTCTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGCATACCGGAGTTCGTCGACCAGGCCATCAAGCAGGATCAGTTTCAGGTTCGCTCAGAG
GGTCCGGATCAGGCAGCCAGAGACTCGGAACGGCACAGCGTTTCCGTAATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGCCAGATCTTCGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTTTACTGCGACGCCGTGGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGGTGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTCTATGCCGAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAG
GAGCTGGACAAGCTGGAGAAGAGCATGAACTCGGAGGCGTGCGCGCTGGTGCTCCGGCAGATGGAGAGCCCCAGG
GCCAAGGCACGGAAGCCCAGCAAATACACCTTTACCATCAAAGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGAC
CCCAACGGCTACAGCGATCCATACGTCGTCTTCGGCGACGAGTATCAGAAGCGTCTCCACAAGACGCGCGTCATC
CATCGAAGCCTCAACCCCCGTTGGGACGAGTCGTTCGAGATTACGGTGCAGGGTCCGATCAACGTCATCGCGACG
ATATGGGACCACGACACGTTCGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTT
GGCGACTACCTGCCCCGCGAGCTGTGGCTGGATCTGGATCTGCAGGGTCGCCTGCTGATGAGGGTCAGCATGGAA
GGGGAGCGAGACGACATCGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGGACGGAGAGGGACATGGTC
CGCAAGGTCACGGACAAGCTCATCACGCATATCACGGCGACGCTGTCCCCGGAAACGATCCGGGGCGTTCTCGGT
CACGGTGGCGTTCTCGGCGCCTCAGTGACGAGCCTGTGGAAGAAGCGAGCGGCCAAGGCGCCGACCACGACGGTC
AGCCAGGTGGAAGGGGCGCTGGCGCCCTTGTTCACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTG
ACCGAGGCGACGATGACGGCCGTCATGACGCGGCTGTGGAAGGAGGTGTTGATGGCGATTGAGAACCTCCTAGTC
CCTCCTTTGTCGGAGAAGCCGTCGACGAAGAAGCCGCTGACGCGTCGGGAGCTGGACGTGGTATATCACTGGCTG
GAGATGCTCTTCACCTTTTTCAACGCCAGAGACGAGGACTCTGGTGAGCAGCTCGGGGTTCCGGGCGAGGTGCTC
AAGTCGCCTAAGTGGCACGAGCTGGCCTCGCTCAATTTCTTCTACCTCGAGGACACGAACAGCCTGATTGGCGAG
TCGGAGCGAATGGCAACGGCAGCGGCCCTGAGGGCGCAGCAAGCGTTGCAGCAGAACCGCATGTCGGCTCCGGCG
GGCCTCGGGTCCGGGATCGGCTCGCTGGCCGGCATGGGGACCATCAAGCGCGGCAAGAGCGTCATGATGAGCCGA
AACCTGGGCACGATGCGCAAGGCCAAGGAGGCCAGACGGCGGGAAGCTCAGGCGGAGCCGAGCGACGACATGATC
CTGCGTATCCTGCGCATGAGGCCCGATGCGGCGCAGTACCTCAAGGAGAGGCACCGGCAGAAGGAGCGGCAGGCT
GCGGCGGCGGCGGCGGCGCTGATTGTCAAGAACAGCGTGATGCAGAGTTGGAACAGAGGGGGGTGA
Gene >Ophcf2|07151
ATGTCGACAGCCTCGCGTCAATCTCAGGTAGCCAACCTCTCGAACGCCTCGCGCAACTCTCGACCGCCCAGTCGT
CGCCCTCGCCACGTCCCGTCCAGGACACGATCCTCCGTCCACCATCTGGCCGTCGAGCACGATGTCGCTCGCAGC
TTTGCCCTACGCACCGCCTATCTCCATCATCTTCTGCAGCCCCGGCCTAAGCGCAAGCAATACGTGACCGCGCCA
AAGCAACGATCCTATACCTCAGTAACCCAGCTCCTCCACGAGTATGTCTCTGGAAGCTCGTCCAGCCTGAAGCTC
CCCCACGCCTTTGCTACCCAACTGCTCGACCGCGTCGGAGGCGTCGTCCGCGGCAGCGAGACGCTCCCCGGCTTC
AACGACGCCGCCGTCAAGCGCAGCTTCGCCGAAGCCTACACCGCCTTTTCCGAAAAGGCCTTTCGCAAGTCCATC
GACAAGGAGAGGAAGTTTGAGCCACTTGTTCTCATCTTCTACTCTGCCGCCACAAAGTCTGCCCAGAAAGGACGG
TTGCCTGACGACGACTCGTGGAAGATCCTTCCGGATCGCCACCTGGCCTTGTTTCTCCGTCTCGCCGCCGACATC
CTCCGCAACCATGGTCACGACCGCGACCGGCCGGACCTCATGTCAAGGCTGCTCACGCTCGAGAGCAAGATCCTC
ACCAACGACCAGAACCTGTTCGAGACGGGCCCCGACGGCGCCGGCACGGCCGTCGAGGTAGCCGTGCCTCTGACC
TACGGTGTCAAGGACATGCCCATGGTGCAGATCGTCGCGGCCATCTTTGGTCTGAGCCAGTCCGAGGTTCAGGCC
GAGATCGACGACAAACGCACCGTCTGGACAGAAGAGGCAGCCCTCAGGGACCTCAAGTCGTACCAGCTGCGTCTC
AACTCGGACAAGCCCGGTGCGCTGAGAAGCCAAGACTTTGACAGCGTCGATGCCTTCAACGACTGGAAGAAGTCG
GAGGCGCCGCACCTGTCGCAGATGATGCTGGACATCCTGACTGTCAAGCCAGAATTGACCAAGCGGTCGACCGCC
CGAGCCGAAAAGACTTCGGCAAGCCGGCCGCAGTCGCTATACCTCGACGACCCGGTCTGTGTGAGTCCCACCCGG
CCCGTGTCCATGTTCGGAGACGGCCTGGCCGGTTTCGACTCCCTGTCCATCGACTCGGATGCGAGCATAAACGAG
CCAGTCTACACCTTTACCCCTCCCAATCCTCTCGCCTTCTACAAGTACATCATCCAGCACGCCATGGCCTTTGAT
CAGCTCCACGCCGACCCGGAGCTGGACTACCAGCCCCTCTCGAAGCAGTCGATGGAGCTGGCGACGGAGCTCTGC
GTGCGATGGCGCATTCCCCAATCTGCTCGGCTGATTGCCCTCCTTGCCGTGGCGACCCGTAAGTTTGTGGACCGC
GAGATTGTGCCTACCGAGCTGGACGCCATCTTCGACCTGGTCAAGTCGCCTCTGCCAGAGGCCAAGAAGCCCCCT
CATATAACTCAATACGCGGCCGCTCTCACGGACATCGACCCGAGCAGGTGGACAGTCGACGACTTCACCATCTAC
CAGGGGACCTTGCATACCCTTCACGACACACTCCTCCGTGAGCTCTACGACCTACTCGGGCAGTGCTACGACGCG
AAGCCGCCCGACATCGCCGCCATCATGTTCCTCCTCGAGAATCACATCGGCAGCGATCCGGTGTTTTCCCCGAGC
CCCGCCGCGTATGTCGAATTCTCCGACCAGCTGGCCCAGGGTCTGGCTCGGCGAGCAGCCGACGTCTATCGTGAG
TACATGGAAAAGGAGATACCGGCCCACAAGGAGGAGTGGGAATTCGGCCATGTCGTCAAGCTGGGCAAGTCGGTG
ACGAAGCTGTGCGATCGAATCCGCAAGAGATACAGGAACACACCTGAAATCATGGGGGTCAACCCGCTGGAGATT
CTGGTGGCAGAGGTGCTGCCCAGCTTCGAGGGCGATGCCGGAGCCATCGTCGAAGCCATCCTCAGCGGCGCCGCC
GAGACGGGCGACGAAGTCGAGATCCAGGAAGGTTTTGATCTCTACAAGGAGCTGGTCGAGATTCGCCGAGTCCAC
CAACAATCTCTCCCAGAGATCCCGTTGGCGGTCAACGTCGAGGATCTGCTCTCCAGCTTCGTCTGGCGATGGATC
CGCAACGCCGAGGAGCGCATACCGGAGTTCGTCGACCAGGCCATCAAGCAGGATCAGTTTCAGGTTCGCTCAGAG
GGTCCGGATCAGGCAGCCAGAGACTCGGAACGGCACAGCGTTTCCGTAATCGATCTCTTCATGCTCTTTAATCAG
ACCGTCGGCCAGATCTTCGCGCTCGAATGGGGCAATGAGGTGCATCATGCCAAGTTCATGACGGCCATCGCGCGC
ATCATCACGACCGGCATCGGCCTTTACTGCGACGCCGTGGAGCAGCGCTTCGCCAAGGAGATGGACCGACTGTCA
GCAGACGAGCTGGCGGTGCAGACCAAGACGGCGCAGGAGAGGTGGGTGCAGATGGCCAAGGACGCGTGGAGCAAC
AAGGAGAAGGTTGAGCCCTTTCAGTTCTATGCCGAGGTGAGAGGTGCCCTTGTCTCTTGTTTCTCAGTTGCCGAA
GACTGACTTGTGACTGCAGTCGTTTGTCAAGCTCAACAACATCGAATACGCCATGCAGGAGCTGGACAAGCTGGA
GAAGAGCATGAACTCGGAGGCGTGCGCGCTGGTGCTCCGGCAGATGGAGAGCCCCAGGGCCAAGGCACGGAAGCC
CAGCAAATACACCTTTACCATCAAAGTCGTCGAGGCCGAGGACGTCAAGGCCTGCGACCCCAACGGCTACAGCGA
TCCATACGTCGTCTTCGGCGACGAGTATCAGAAGCGTCTCCACAAGACGCGCGTCATCCATCGAAGCCTCAACCC
CCGTTGGGACGAGTCGTTCGAGATTACGGTGCAGGGTCCGATCAACGTCATCGCGACGATATGGGACCACGACAC
GTTCGGCGATCACGACTACGTCGGCCGGACGGCGCTCAAGCTCGACCCGGCACACTTTGGCGACTACCTGCCCCG
CGAGCTGTGGCTGGATCTGGATCTGCAGGGTCGCCTGCTGATGAGGGTCAGCATGGAAGGGGAGCGAGACGACAT
CGAGTTCCACTTTGGCAAGGCGTTTCGCCACCTGAAGCGGACGGAGAGGGACATGGTCCGCAAGGTCACGGACAA
GGTATGAATTGAGTGCGGCGCCTTGGTCTCGTGAGGAATGCTGACGCGGTATCGTGACAGCTCATCACGCATATC
ACGGCGACGCTGTCCCCGGAAACGATCCGGGGCGTTCTCGGTCACGGTGGCGTTCTCGGCGCCTCAGTGACGAGC
CTGTGGAAGAAGCGAGCGGCCAAGGCGCCGACCACGACGGTCAGCCAGGTGGAAGGGGCGCTGGCGCCCTTGTTC
ACCTACTTTGACGAGAACTTTGCCATCATGAAGCAGACGCTGACCGAGGCGACGATGACGGCCGTCATGACGCGG
CTGTGGAAGGAGGTGTTGATGGCGATTGAGAACCTCCTAGTCCCTCCTTTGTCGGAGAAGCCGTCGACGAAGAAG
CCGCTGACGCGTCGGGAGCTGGACGTGGTATATCACTGGCTGGAGATGCTCTTCACCTTTTTCAACGCCAGAGAC
GAGGACTCTGGTGAGCAGCTCGGGGTTCCGGGCGAGGTGCTCAAGTCGCCTAAGTGGCACGAGCTGGCCTCGCTC
AATTTCTTCTACCTCGAGGACACGAACAGCCTGATTGGCGAGTCGGAGCGAATGGCAACGGCAGCGGCCCTGAGG
GCGCAGCAAGCGTTGCAGCAGAACCGCATGTCGGCTCCGGCGGGCCTCGGGTCCGGGATCGGCTCGCTGGCCGGC
ATGGGGACCATCAAGCGCGGCAAGAGCGTCATGATGAGCCGAAACCTGGGCACGATGCGCAAGGCCAAGGAGGCC
AGACGGCGGGAAGCTCAGGCGGAGCCGAGCGACGACATGATCCTGCGTATCCTGCGCATGAGGCCCGATGCGGCG
CAGTACCTCAAGGAGAGGCACCGGCAGAAGGAGCGGCAGGCTGCGGCGGCGGCGGCGGCGCTGATTGTCAAGAAC
AGCGTGATGCAGAGTTGGAACAGAGGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail